OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RBAKDN (NM_203393) Human Mass Spec Standard

Be the first to review this product
SKU
PH306721
LOC389458 MS Standard C13 and N15-labeled recombinant protein (NP_976327)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY404334 Transient overexpression lysate of hypothetical gene supported by BC031661 (LOC389458) (as WB positive control) 100 ug
$436.00

Other products for "LOC389458 or NM_203393"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206721
Predicted MW 12.7 kDa
Protein Sequence
Protein Sequence
>RC206721 representing NM_203393
Red=Cloning site Green=Tags(s)

MLTPRKSFRTCSKASGLAETESCGQTHTWPRALAVLMGLWWPRDQKAGEEDLRFRERRPGLQATATGSGE
HGAFPVHSQGVWASTHWQGTAVCPLQTPPPDAFIRNNKVLS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_976327
RefSeq Size 544
RefSeq ORF 333
Synonyms MGC:35170
Locus ID 389458
Cytogenetics 7p22.1
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "LOC389458" proteins (3)
SKU Description Size Price
LC404334 Lyophilized LOC389458 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404334 Transient overexpression lysate of hypothetical gene supported by BC031661 (LOC389458) (as WB positive control) 100 ug
$436.00
TP306721 Recombinant protein of human hypothetical gene supported by BC031661 (LOC389458), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products