OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NPTX2 (NM_002523) Human Mass Spec Standard

Be the first to review this product
SKU
PH306713
NPTX2 MS Standard C13 and N15-labeled recombinant protein (NP_002514)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA306565 Rabbit Polyclonal NPTX2 Antibody
100 ug
$640.00
LY419275 Transient overexpression lysate of neuronal pentraxin II (NPTX2) (as WB positive control) 100 ug
$436.00

Other products for "NPTX2 or NM_002523"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206713
Predicted MW 46.9 kDa
Protein Sequence
Protein Sequence
>RC206713 representing NM_002523
Red=Cloning site Green=Tags(s)

MLALLAASVALAVAAGAQDSPAPGSRFVCTALPPEAVHAGCPLPAMPMQGGAQSPEEELRAAVLQLRETV
VQQKETLGAQREAIRELTGKLARCEGLAGGKARGAGATGKDTMGDLPRDPGHVVEQLSRSLQTLKDRLES
LEHQLRANVSNAGLPGDFREVLQQRLGELERQLLRKVAELEDEKSLLHNETSAHRQKTESTLNALLQRVT
ELERGNSAFKSPDAFKVSLPLRTNYLYGKIKKTLPELYAFTICLWLRSSASPGIGTPFSYAVPGQANEIV
LIEWGNNPIELLINDKVAQLPLFVSDGKWHHICVTWTTRDGMWEAFQDGEKLGTGENLAPWHPIKPGGVL
ILGQEQDTVGGRFDATQAFVGELSQFNIWDRVLRAQEIVNIANCSTNMPGNIIPWVDNNVDVFGGASKWP
VETCEERLLDL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002514
RefSeq Size 2746
RefSeq ORF 1293
Synonyms NARP; NP-II; NP2
Locus ID 4885
UniProt ID P47972
Cytogenetics 7q22.1
Summary This gene encodes a member of the family of neuronal petraxins, synaptic proteins that are related to C-reactive protein. This protein is involved in excitatory synapse formation. It also plays a role in clustering of alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA)-type glutamate receptors at established synapses, resulting in non-apoptotic cell death of dopaminergic nerve cells. Up-regulation of this gene in Parkinson disease (PD) tissues suggests that the protein may be involved in the pathology of PD. provided by RefSeq, Feb 2009
Protein Families Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NPTX2" proteins (5)
SKU Description Size Price
LC419275 Lyophilized NPTX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419275 Transient overexpression lysate of neuronal pentraxin II (NPTX2) (as WB positive control) 100 ug
$436.00
TP306713 Recombinant protein of human neuronal pentraxin II (NPTX2), 20 µg 20 ug
$737.00
TP701051 Purified recombinant protein of Human neuronal pentraxin II (NPTX2), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug 50 ug
$900.00
TP710206 Purified recombinant protein of Human neuronal pentraxin II (NPTX2), full length, with C-terminal DDK tag, expressed in sf9, 20ug 20 ug
$540.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products