OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RTL6 (NM_032287) Human Mass Spec Standard

Be the first to review this product
SKU
PH306668
LDOC1L MS Standard C13 and N15-labeled recombinant protein (NP_115663)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA315905 Rabbit polyclonal anti-LDOCL antibody
100 ul
$380.00
LY410230 Transient overexpression lysate of leucine zipper, down-regulated in cancer 1-like (LDOC1L) (as WB positive control) 100 ug
$436.00

Other products for "RTL6 or NM_032287"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206668
Predicted MW 26.2 kDa
Protein Sequence
Protein Sequence
>RC206668 protein sequence
Red=Cloning site Green=Tags(s)

MVQPQTSKAESPALAASPNAQMDDVIDTLTSLRLTNSALRREASTLRAEKANLTNMLESVMAELTLLRTR
ARIPGALQITPPISSITSNGTRPMTTPPTSLPEPFSGDPGRLAGFLMQMDRFMIFQASRFPGEAERVAFL
VSRLTGEAEKWAIPHMQPDSPLRNNYQGFLAELRRTYKSPLRHARRAQIRKTSASNRAVRERQMLCRQLA
SAGTGPCPVHPASNGTSPAPALPARARNL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_115663
RefSeq Size 5355
RefSeq ORF 717
Synonyms dJ1033E15.2; LDOC1L; Mar6; Mart6; SIRH3
Locus ID 84247
UniProt ID Q6ICC9
Cytogenetics 22q13.31
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RTL6" proteins (3)
SKU Description Size Price
LC410230 Lyophilized LDOC1L HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410230 Transient overexpression lysate of leucine zipper, down-regulated in cancer 1-like (LDOC1L) (as WB positive control) 100 ug
$436.00
TP306668 Recombinant protein of human leucine zipper, down-regulated in cancer 1-like (LDOC1L), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products