OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TMEM252 (NM_153237) Human Mass Spec Standard

Be the first to review this product
SKU
PH306657
C9orf71 MS Standard C13 and N15-labeled recombinant protein (NP_694969)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Other products for "TMEM252 or NM_153237"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206657
Predicted MW 18.5 kDa
Protein Sequence
Protein Sequence
>RC206657 representing NM_153237
Red=Cloning site Green=Tags(s)

MQNRTGLILCALALLMGFLMVCLGAFFISWGSIFDCQGSLIAAYLLLPLGFVILLSGIFWSNYRQVTESK
GVLRHMLRQHLAHGALPVATVDRPDFYPPAYEESLEVEKQSCPAEREASGIPPPLYTETGLEFQDGNDSH
PEAPPSYRESIAGLVVTAISEDAQRRGQEC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_694969
RefSeq Size 1284
RefSeq ORF 510
Synonyms C9orf71
Locus ID 169693
UniProt ID Q8N6L7
Cytogenetics 9q21.11
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TMEM252" proteins (1)
SKU Description Size Price
TP306657 Recombinant protein of human chromosome 9 open reading frame 71 (C9orf71), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products