OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RAI2 (NM_021785) Human Mass Spec Standard

Be the first to review this product
SKU
PH306638
RAI2 MS Standard C13 and N15-labeled recombinant protein (NP_068557)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA359264 RAI2 Antibody - C-terminal region
100 ul
$585.00
LY411926 Transient overexpression lysate of retinoic acid induced 2 (RAI2) (as WB positive control) 100 ug
$436.00

Other products for "RAI2 or NM_021785"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206638
Predicted MW 57.2 kDa
Protein Sequence
Protein Sequence
>RC206638 protein sequence
Red=Cloning site Green=Tags(s)

MDDLQSQNLSMDMTDSPPALANNRLENGMAQLITTEAWNINSTDLVKKALVTVPAPSILNPPAESQSGMA
LKVAATVLQPLCLGESPVVMPIHMQVEGSSAPELNPNGNATYVMTTQGPVQLPVVLEQHVFQHLNSPLVL
PQEAPCSSSTIHNNLFQGAEDPEAQPQLLDLRIPSQPQEPTLPFEAVLQNLFPSQGTLGPPPCQPPPGYA
PVPPQPFSSPLSPLVPPATLLVPYPVIVPLPVPVPIPIPIPVPQSSESKFSSSFPKPPSSFGLHPFKGTQ
TPLEKDELKPFDILQPKEYFQLSRHTVIKMGSENEALDLSMKSVPWLKAGEVSPPIFQEDAPLDLSVAAH
RKSEPPPETLYDSGASVDSSGHTVMEKLPSGMEISFAPATSHEAPAMMDSHISSSDAATEMLSQPNHPSG
EVKAENNIEMVGESQAAKVIVSVEDAVPTIFCGKIKGLSGVSTKNFSFKREDSVLQGYDINSQGEESMGN
AEPLRKPIKNRSIKLKKVNSQEIHMLPIKKQRLATFFPRK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_068557
RefSeq Size 2229
RefSeq ORF 1590
Locus ID 10742
UniProt ID Q9Y5P3
Cytogenetics Xp22.13
Summary Retinoic acid plays a critical role in development, cellular growth, and differentiation. The specific function of this retinoic acid-induced gene has not yet been determined but it may play a role in development. The chromosomal location of this gene designates it to be a candidate for diseases such as Nance-Horan syndrome, sensorineural deafness, non-specific X-linked cognitive disability, oral-facial-digital syndrome, and Fried syndrome. Alternate splicing results in multiple transcript variants. provided by RefSeq, Feb 2010
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RAI2" proteins (7)
SKU Description Size Price
LC411926 Lyophilized RAI2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC433148 Lyophilized RAI2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC433236 Lyophilized RAI2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411926 Transient overexpression lysate of retinoic acid induced 2 (RAI2) (as WB positive control) 100 ug
$436.00
LY433148 Transient overexpression lysate of retinoic acid induced 2 (RAI2), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY433236 Transient overexpression lysate of retinoic acid induced 2 (RAI2), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP306638 Recombinant protein of human retinoic acid induced 2 (RAI2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products