OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MPPED2 (NM_001584) Human Mass Spec Standard

Be the first to review this product
SKU
PH306617
MPPED2 MS Standard C13 and N15-labeled recombinant protein (NP_001575)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA365776 MPPED2 rabbit polyclonal antibody
100 ul
$310.00
LY419851 Transient overexpression lysate of metallophosphoesterase domain containing 2 (MPPED2), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "MPPED2 or NM_001584"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206617
Predicted MW 33.4 kDa
Protein Sequence
Protein Sequence
>RC206617 protein sequence
Red=Cloning site Green=Tags(s)

MAHGIPSQGKVTITVDEYSSNPTQAFTHYNINQSRFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRT
DGIQMPYGDILLHTGDFTELGLPSEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPS
VSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRGQSLLDKWNLIPEGIDIL
MTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGGIHEGYGIMTDGYTTYINASTCTVSFQPT
NPPIIFDLPNPQGS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001575
RefSeq Size 2404
RefSeq ORF 882
Synonyms 239FB; C11orf8
Locus ID 744
UniProt ID Q15777
Cytogenetics 11p14.1
Summary This gene likely encodes a metallophosphoesterase. The encoded protein may play a role a brain development. Alternatively spliced transcript variants have been described. provided by RefSeq, Feb 2009
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MPPED2" proteins (3)
SKU Description Size Price
LC419851 Lyophilized MPPED2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419851 Transient overexpression lysate of metallophosphoesterase domain containing 2 (MPPED2), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP306617 Recombinant protein of human metallophosphoesterase domain containing 2 (MPPED2), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products