OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CD2 (NM_001767) Human Mass Spec Standard

Be the first to review this product
SKU
PH306612
CD2 MS Standard C13 and N15-labeled recombinant protein (NP_001758)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA800655 CD2 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5) 100 ul
$447.00
LY400671 Transient overexpression lysate of CD2 molecule (CD2) (as WB positive control) 100 ug
$436.00

Other products for "CD2 or NM_001767"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206612
Predicted MW 39.4 kDa
Protein Sequence
Protein Sequence
>RC206612 protein sequence
Red=Cloning site Green=Tags(s)

MSFPCKFVASFLLIFNVSSKGAVSKEITNALETWGALGQDINLDIPSFQMSDDIDDIKWEKTSDKKKIAQ
FRKEKETFKEKDTYKLFKNGTLKIKHLKTDDQDIYKVSIYDTKGKNVLEKIFDLKIQERVSKPKISWTCI
NTTLTCEVMNGTDPELNLYQDGKHLKLSQRVITHKWTTSLSAKFKCTAGNKVSKESSVEPVSCPEKGLDI
YLIIGICGGGSLLMVFVALLVFYITKRKKQRSRRNDEELETRAHRVATEERGRKPQQIPASTPQNPATSQ
HPPPPPGHRSQAPSHRPPPPGHRVQHQPQKRPPAPSGTQVHQQKGPPLPRPRVQPKPPHGAAENSLSPSS
N

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001758
RefSeq Size 1595
RefSeq ORF 1053
Synonyms LFA-2; SRBC; T11
Locus ID 914
UniProt ID P06729
Cytogenetics 1p13.1
Summary The protein encoded by this gene is a surface antigen found on all peripheral blood T-cells. The encoded protein interacts with LFA3 (CD58) on antigen presenting cells to optimize immune recognition. A locus control region (LCR) has been found in the 3' flanking sequence of this gene. provided by RefSeq, Jun 2016
Protein Families Druggable Genome, Transmembrane
Protein Pathways Cell adhesion molecules (CAMs), Hematopoietic cell lineage
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CD2" proteins (6)
SKU Description Size Price
LC400671 Lyophilized CD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400671 Transient overexpression lysate of CD2 molecule (CD2) (as WB positive control) 100 ug
$436.00
TP306612 Purified recombinant protein of Homo sapiens CD2 molecule (CD2), 20 µg 20 ug
$737.00
TP700239 Purified recombinant protein of human CD2 molecule (CD2), with C-terminal DDK/His tag, expressed in human cells, 20 µg 20 ug
$900.00
TP721123 Purified recombinant protein of Human CD2 molecule (CD2) 10 ug
$340.00
TP761130 Purified recombinant protein of Human CD2 molecule (CD2), full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products