HSD17B3 (NM_000197) Human Mass Spec Standard

CAT#: PH306558

HSD17B3 MS Standard C13 and N15-labeled recombinant protein (NP_000188)

Product Images

Coomassie blue staining of purified HSD17B3 protein (Cat# TP306558). The protein was produced from HEK293T cells transfected with HSD17B3 cDNA clone (Cat# RC206558) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206558
• Predicted MW: 34.5 kDa
• Protein Sequence:
  Sequence Link

  >RC206558 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGDVLEQFFILTGLLVCLACLAKCVRFSRCVLLNYWKVLPKSFLRSMGQWAVITGAGDGIGKAYSFELAK
  RGLNVVLISRTLEKLEAIATEIERTTGRSVKIIQADFTKDDIYEHIKEKLAGLEIGILVNNVGMLPNLLP
  SHFLNAPDEIQSLIHCNITSVVKMTQLILKHMESRQKGLILNISSGIALFPWPLYSMYSASKAFVCAFSK
  ALQEEYKAKEVIIQVLTPYAVSTAMTKYLNTNVITKTADEFVKESLNYVTIGGETCGCLAHEILAGFLSL
  IPAWAFYSGAFQRLLLTHYVAYLKLNTKVR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000188
• RefSeq Size: 1134
• RefSeq ORF: 930
• Synonyms: EDH17B3; SDR12C2
• Locus ID: 3293
• UniProt ID: P37058, Q6FH62, G5E9S2
• Cytogenetics: 9q22.32
• Summary: This isoform of 17 beta-hydroxysteroid dehydrogenase is expressed predominantly in the testis and catalyzes the conversion of androstenedione to testosterone. It preferentially uses NADP as cofactor. Deficiency can result in male pseudohermaphroditism with gynecomastia. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Androgen and estrogen metabolism, Metabolic pathways