OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

COX6A2 (NM_005205) Human Mass Spec Standard

Be the first to review this product
SKU
PH306539
COX6A2 MS Standard C13 and N15-labeled recombinant protein (NP_005196)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY417442 Transient overexpression lysate of cytochrome c oxidase subunit VIa polypeptide 2 (COX6A2), nuclear gene encoding mitochondrial protein (as WB positive control) 100 ug
$436.00

Other products for "COX6A2 or NM_005205"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206539
Predicted MW 10.8 kDa
Protein Sequence
Protein Sequence
>RC206539 protein sequence
Red=Cloning site Green=Tags(s)

MALPLRPLTRGLASAAKGGHGGAGARTWRLLTFVLALPSVALCTFNSYLHSGHRPRPEFRPYQHLRIRTK
PYPWGDGNHTLFHNSHVNPLPTGYEHP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005196
RefSeq Size 441
RefSeq ORF 291
Synonyms COX6AH; COXVIAH; MC4DN18
Locus ID 1339
UniProt ID Q02221
Cytogenetics 16p11.2
Summary Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes polypeptide 2 (heart/muscle isoform) of subunit VIa, and polypeptide 2 is present only in striated muscles. Polypeptide 1 (liver isoform) of subunit VIa is encoded by a different gene, and is found in all non-muscle tissues. These two polypeptides share 66% amino acid sequence identity. provided by RefSeq, Jul 2008
Protein Pathways Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "COX6A2" proteins (3)
SKU Description Size Price
LC417442 Lyophilized COX6A2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417442 Transient overexpression lysate of cytochrome c oxidase subunit VIa polypeptide 2 (COX6A2), nuclear gene encoding mitochondrial protein (as WB positive control) 100 ug
$436.00
TP306539 Recombinant protein of human cytochrome c oxidase subunit VIa polypeptide 2 (COX6A2), nuclear gene encoding mitochondrial protein, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products