COX6A2 (NM_005205) Human Tagged ORF Clone

SKU RC206539

COX6A2 (Myc-DDK-tagged)-Human cytochrome c oxidase subunit VIa polypeptide 2 (COX6A2), nuclear gene encoding mitochondrial protein

Product Data

• Type: Human Tagged ORF Clone
• Target Symbol: COX6A2
• Synonyms: COX6AH; COXVIAH; MC4DN18
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC206539 ORF sequence; Red=Cloning site Blue=ORF Green=Tags(s); ; TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC; GCCGCGATCGCC; ; ATGGCTTTGCCTCTGAGGCCCCTGACCCGGGGCTTGGCCAGCGCTGCCAAAGGAGGCCACGGAGGAGCAG; GAGCTCGTACCTGGCGTCTGCTGACCTTCGTGCTGGCGCTGCCCAGCGTGGCCCTCTGCACCTTCAACTC; CTATCTCCACTCGGGCCACCGCCCGCGCCCCGAGTTCCGTCCCTACCAACACCTCCGCATCCGCACCAAG; CCCTACCCCTGGGGGGACGGCAACCACACTCTGTTCCACAATAGCCACGTGAACCCTCTGCCCACGGGCT; ACGAACACCCC; ; ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT; ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC206539 protein sequence; Red=Cloning site Green=Tags(s); ; MALPLRPLTRGLASAAKGGHGGAGARTWRLLTFVLALPSVALCTFNSYLHSGHRPRPEFRPYQHLRIRTK; PYPWGDGNHTLFHNSHVNPLPTGYEHP; ; myc-FLAG tag
• Chromatograms: Chromatograms ; Sequencher program is needed, download here
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_005205
• ORF Size: 291 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution Method: 1. Centrifuge at 5,000xg for 5min.; 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.; 3. Close the tube and incubate for 10 minutes at room temperature.; 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.; 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
• Note: Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required.
• Shipping: Ambient

Reference Data

• RefSeq: NM_005205.4
• RefSeq Size: 441 bp
• RefSeq ORF: 294 bp
• Locus ID: 1339
• UniProt ID: Q02221
• Cytogenetics: 16p11.2
• Domains: COX6A
• Protein Pathways: Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease
• MW: 10.8 kDa
• Summary: Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes polypeptide 2 (heart/muscle isoform) of subunit VIa, and polypeptide 2 is present only in striated muscles. Polypeptide 1 (liver isoform) of subunit VIa is encoded by a different gene, and is found in all non-muscle tissues. These two polypeptides share 66% amino acid sequence identity. [provided by RefSeq, Jul 2008]