OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EFCAB1 (NM_024593) Human Mass Spec Standard

Be the first to review this product
SKU
PH306419
EFCAB1 MS Standard C13 and N15-labeled recombinant protein (NP_078869)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA335466 Rabbit Polyclonal Anti-EFCAB1 Antibody
100 ul
$585.00
LY411209 Transient overexpression lysate of EF-hand calcium binding domain 1 (EFCAB1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "EFCAB1 or NM_024593"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206419
Predicted MW 24.5 kDa
Protein Sequence
Protein Sequence
>RC206419 protein sequence
Red=Cloning site Green=Tags(s)

MNRKKLQKLTDTLTKNCKHFNKFEVNCLIKLFYDLVGGVERQGLVVGLDRNAFRNILHVTFGMTDDMIMD
RVFRGFDKDNDGCVNVLEWIHGLSLFLRGSLEEKMKYCFEVFDLNGDGFISKEEMFHMLKNSLLKQPSEE
DPDEGIKDLVEITLKKMDHDHDGKLSFADYELAVREETLLLEAFGPCLPDPKSQMEFEAQVFKDPNEFND
M

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_078869
RefSeq Size 2144
RefSeq ORF 633
Locus ID 79645
UniProt ID Q9HAE3
Cytogenetics 8q11.21
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "EFCAB1" proteins (5)
SKU Description Size Price
LC411209 Lyophilized EFCAB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428290 Lyophilized EFCAB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411209 Transient overexpression lysate of EF-hand calcium binding domain 1 (EFCAB1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY428290 Transient overexpression lysate of EF-hand calcium binding domain 1 (EFCAB1), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP306419 Recombinant protein of human EF-hand calcium binding domain 1 (EFCAB1), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products