GMEB2 (NM_012384) Human Mass Spec Standard

CAT#: PH306407

GMEB2 MS Standard C13 and N15-labeled recombinant protein (NP_036516)

Product Images

Coomassie blue staining of purified GMEB2 protein (Cat# TP306407). The protein was produced from HEK293T cells transfected with GMEB2 cDNA clone (Cat# RC206407) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206407
• Predicted MW: 56.2 kDa
• Protein Sequence:
  Sequence Link

  >RC206407 representing NM_012384
  Red=Cloning site Green=Tags(s)
  
  MATPDVSVHMEEVVVVTTPDTAVDGSGVEGVKTVLVTTNLAPHGGDLTEDNMETENAAAAAAAAFTASSQ
  LKEAVLVKMAEEGENLEAEIVYPITCGDSRANLIWRKFVCPGINVKCVQYDEHVISPKEFVHLAGKSTLK
  DWKRAIRMNGIMLRKIMDSGELDFYQHDKVCSNTCRSTKIDLSGARVSLSSPTSAEYIPLTPAAADVNGS
  PATITIETCEDPGDWTAAIGDDTFTFWRGLKDAGLLDEVIQEFHQELVETMRGLQQRVQDPPLQLRDAVL
  LNNIVQNFGMLDLVKKVLASHKCQMDRSREQYARDLAALEQQCDEHRRRAKELKHKSQHLSNVLMTLTPV
  SLPPPVKRPRLARATSGPAAMASQVLTQSAQLALGPGVPVPQLTSVPLGKVVSTLPSTVLGKGSLQAPPA
  SSPASPLLGGYTVLASSGSTYPSTVEIHPDASSLTVLSTAAVQDGSTVFKVVSPLQLLTLPGLGPTLQNV
  AQASPGSSTIVTVPAGAAPGPEEHTATIEVAAMAEDHERK
  
  SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_036516
• RefSeq Size: 4559
• RefSeq ORF: 1590
• Synonyms: GMEB-2; P79PIF; PIF79
• Locus ID: 26205
• UniProt ID: Q9UKD1, B4DQS0
• Cytogenetics: 20q13.33
• Summary: This gene is a member of KDWK gene family. The product of this gene associates with GMEB1 protein, and the complex is essential for parvovirus DNA replication. Study of rat homolog implicates the role of this gene in modulation of transactivation by the glucocorticoid receptor bound to glucocorticoid response elements. This gene appears to use multiple polyadenylation sites. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transcription Factors