OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NR1D2 (NM_005126) Human Mass Spec Standard

Be the first to review this product
SKU
PH306338
NR1D2 MS Standard C13 and N15-labeled recombinant protein (NP_005117)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA806588 NR1D2 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4) 100 ul
$447.00
LY417483 Transient overexpression lysate of nuclear receptor subfamily 1, group D, member 2 (NR1D2), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "NR1D2 or NM_005126"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206338
Predicted MW 64.7 kDa
Protein Sequence
Protein Sequence
>RC206338 protein sequence
Red=Cloning site Green=Tags(s)

MEVNAGGVIAYISSSSSASSHASCHSEGSENSFQSSSSSVPSSPNSSNSDTNGNPKNGDLANIEGILKND
RIDCSMKTSKSSAPGMTKSHSGVTKFSGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKKC
LKNENCSIMRMNRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLIEMQSAMKTMMNSQFSGHLQND
TLVEHHEQTALPAQEQLRPKPQLEQENIKSSSPPSSDFAKEEVIGMVTRAHKDTFMYNQEQQENSAESMQ
PKRGERIRKNMEQYNLNHDHCGNGLSSHFPCSESQQHLNGQFKGRNIMHYPNGHAICIANGHCMNFSNAY
TQRVCDRVPIDGFSQNENKNSYLCNTGGRMHLVCPMSKSPYVDPHKSGHEIWEEFSMSFTPAVKEVVEFA
KRIPGFRDLSQHDQVNLLKAGTFEVLMVRFASLFDAKERTVTFLSGKKYSVDDLHSMGAGDLLNSMFEFS
EKLNALQLSDEEMSLFTAVVLVSADRSGIENVNSVEALQETLIRALRTLIMKNHPNEASIFTKLLLKLPD
LRSLNNMHSEELLAFKVHP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005117
RefSeq Size 5268
RefSeq ORF 1737
Synonyms BD73; EAR-1R; REVERBB; REVERBbeta; RVR
Locus ID 9975
UniProt ID Q14995
Cytogenetics 3p24.2
Summary This gene encodes a member of the nuclear hormone receptor family, specifically the NR1 subfamily of receptors. The encoded protein functions as a transcriptional repressor and may play a role in circadian rhythms and carbohydrate and lipid metabolism. Alternatively spliced transcript variants have been described. provided by RefSeq, Feb 2009
Protein Families Druggable Genome, Nuclear Hormone Receptor, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NR1D2" proteins (3)
SKU Description Size Price
LC417483 Lyophilized NR1D2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417483 Transient overexpression lysate of nuclear receptor subfamily 1, group D, member 2 (NR1D2), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP306338 Recombinant protein of human nuclear receptor subfamily 1, group D, member 2 (NR1D2), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products