OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MOB4A (MOB1B) (NM_173468) Human Mass Spec Standard

Be the first to review this product
SKU
PH306337
MOBKL1A MS Standard C13 and N15-labeled recombinant protein (NP_775739)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA501388 MOBKL1A (MOB4A) mouse monoclonal antibody, clone OTI1H2 (formerly 1H2) 100 ul
$447.00
LY406621 Transient overexpression lysate of MOB1, Mps One Binder kinase activator-like 1A (yeast) (MOBKL1A) (as WB positive control) 100 ug
$436.00

Other products for "MOB4A or NM_173468"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206337
Predicted MW 25.1 kDa
Protein Sequence
Protein Sequence
>RC206337 protein sequence
Red=Cloning site Green=Tags(s)

MSFLFGSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRMAVMLPEGEDLNEWVAVNTVDFFNQINM
LYGTITDFCTEESCPVMSAGPKYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPF
PKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEK
LTSKDR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_775739
RefSeq Size 6979
RefSeq ORF 648
Synonyms MATS2; MOB4A; MOBKL1A
Locus ID 92597
UniProt ID Q7L9L4
Cytogenetics 4q13.3
Summary The protein encoded by this gene is similar to the yeast Mob1 protein. Yeast Mob1 binds Mps1p, a protein kinase essential for spindle pole body duplication and mitotic checkpoint regulation. Three transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Sep 2011
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MOB4A" proteins (3)
SKU Description Size Price
LC406621 Lyophilized MOB1B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406621 Transient overexpression lysate of MOB1, Mps One Binder kinase activator-like 1A (yeast) (MOBKL1A) (as WB positive control) 100 ug
$436.00
TP306337 Recombinant protein of human MOB1, Mps One Binder kinase activator-like 1A (yeast) (MOBKL1A), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products