OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MAGEB18 (NM_173699) Human Mass Spec Standard

Be the first to review this product
SKU
PH306329
MAGEB18 MS Standard C13 and N15-labeled recombinant protein (NP_775970)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA502648 MAGEB18 mouse monoclonal antibody, clone OTI9F9 (formerly 9F9) 100 ul
$447.00
LY406567 Transient overexpression lysate of melanoma antigen family B, 18 (MAGEB18) (as WB positive control) 100 ug
$436.00

Other products for "MAGEB18 or NM_173699"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206329
Predicted MW 38.5 kDa
Protein Sequence
Protein Sequence
>RC206329 protein sequence
Red=Cloning site Green=Tags(s)

MPRGQKSKLRAREKRHQARCENQDLGATQATVAEGESPSSAYLLFGDRPQNLPAAETPSIPEALQGAPST
TNAIAPVSCSSNEGASSQDEKSLGSSREAEGWKEDPLNKKVVSLVHFLLQKYETKEPITKGDMIKFVIRK
DKCHFNEILKRASEHMELALGVDLKEVDPIRHYYAFFSKLDLTYDETTSDEEKIPKTGLLMIALGVIFLN
GNRAPEEAVWEIMNMMGVYADRKHFLYGDPRKVMTKDLVQLKYLEYQQVPNSDPPRYEFLWGPRAHAETS
KMKVLEFVAKIHDTVPSAFPSCYEEALRDEEQRTQARAAARAHTAAMANARSRTTSSSFSHAK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_775970
RefSeq Size 1812
RefSeq ORF 1029
Locus ID 286514
UniProt ID Q96M61
Cytogenetics Xp21.3
Summary May enhance ubiquitin ligase activity of RING-type zinc finger-containing E3 ubiquitin-protein ligases. Proposed to act through recruitment and/or stabilization of the Ubl-conjugating enzyme (E2) at the E3:substrate complex.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MAGEB18" proteins (3)
SKU Description Size Price
LC406567 Lyophilized MAGEB18 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406567 Transient overexpression lysate of melanoma antigen family B, 18 (MAGEB18) (as WB positive control) 100 ug
$436.00
TP306329 Recombinant protein of human melanoma antigen family B, 18 (MAGEB18), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products