MAGEB18 (NM_173699) Human Recombinant Protein

SKU
TP306329
Recombinant protein of human melanoma antigen family B, 18 (MAGEB18), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC206329 protein sequence
Red=Cloning site Green=Tags(s)

MPRGQKSKLRAREKRHQARCENQDLGATQATVAEGESPSSAYLLFGDRPQNLPAAETPSIPEALQGAPST
TNAIAPVSCSSNEGASSQDEKSLGSSREAEGWKEDPLNKKVVSLVHFLLQKYETKEPITKGDMIKFVIRK
DKCHFNEILKRASEHMELALGVDLKEVDPIRHYYAFFSKLDLTYDETTSDEEKIPKTGLLMIALGVIFLN
GNRAPEEAVWEIMNMMGVYADRKHFLYGDPRKVMTKDLVQLKYLEYQQVPNSDPPRYEFLWGPRAHAETS
KMKVLEFVAKIHDTVPSAFPSCYEEALRDEEQRTQARAAARAHTAAMANARSRTTSSSFSHAK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 38.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_775970
Locus ID 286514
UniProt ID Q96M61
Cytogenetics Xp21.3
RefSeq Size 1812
RefSeq ORF 1029
Summary May enhance ubiquitin ligase activity of RING-type zinc finger-containing E3 ubiquitin-protein ligases. Proposed to act through recruitment and/or stabilization of the Ubl-conjugating enzyme (E2) at the E3:substrate complex.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:MAGEB18 (NM_173699) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH306329 MAGEB18 MS Standard C13 and N15-labeled recombinant protein (NP_775970) 10 ug
$3,255.00
LC406567 MAGEB18 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406567 Transient overexpression lysate of melanoma antigen family B, 18 (MAGEB18) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.