OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RALYL (NM_173848) Human Mass Spec Standard

Be the first to review this product
SKU
PH306313
RALYL MS Standard C13 and N15-labeled recombinant protein (NP_776247)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA344023 Rabbit Polyclonal Anti-RALYL Antibody
100 ul
$585.00
LY406284 Transient overexpression lysate of RALY RNA binding protein-like (RALYL), transcript variant 3 (as WB positive control) 100 ug
$436.00

Other products for "RALYL or NM_173848"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206313
Predicted MW 32.3 kDa
Protein Sequence
Protein Sequence
>RC206313 protein sequence
Red=Cloning site Green=Tags(s)

MTGKTQTSNVTNKNDPKSINSRVFIGNLNTAIVKKVDIEAIFSKYGKIVGCSVHKGYAFVQYMSERHARA
AVAGENARVIAGQPLDINMAGEPKPYRPKPGNKRPLSALYRLESKEPFLSVGGYVFDYDYYRDDFYNRLF
DYHGRVPPPPRAVIPLKRPRVAVTTTRRGKGVFSMKGGSRSTASGSTGSKLKSDELQTIKKELTQIKTKI
DSLLGRLEKIEKQQKAEAEAQKKQLEESLVLIQEECVSEIADHSTEEPAEGGPDADGEEMTDGIEEDFDE
DGGHELFLQIK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_776247
RefSeq Size 2919
RefSeq ORF 873
Synonyms HNRPCL3
Locus ID 138046
UniProt ID Q86SE5
Cytogenetics 8q21.2
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RALYL" proteins (8)
SKU Description Size Price
LC406284 Lyophilized RALYL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420244 Lyophilized RALYL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420245 Lyophilized RALYL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406284 Transient overexpression lysate of RALY RNA binding protein-like (RALYL), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY420244 Transient overexpression lysate of RALY RNA binding protein-like (RALYL), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY420245 Transient overexpression lysate of RALY RNA binding protein-like (RALYL), transcript variant 4 (as WB positive control) 100 ug
$436.00
TP306313 Recombinant protein of human RALY RNA binding protein-like (RALYL), transcript variant 3, 20 µg 20 ug
$867.00
TP760706 Purified recombinant protein of Human RALY RNA binding protein-like (RALYL), transcript variant 4, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products