OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EIF5 (NM_001969) Human Mass Spec Standard

Be the first to review this product
SKU
PH306301
EIF5 MS Standard C13 and N15-labeled recombinant protein (NP_001960)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA349926 Rabbit Polyclonal Anti-EIF5 Antibody
100 ul
$205.00
LY405302 Transient overexpression lysate of eukaryotic translation initiation factor 5 (EIF5), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "EIF5 or NM_001969"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206301
Predicted MW 49.2 kDa
Protein Sequence
Protein Sequence
>RC206301 protein sequence
Red=Cloning site Green=Tags(s)

MSVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVK
NDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTF
ILKNPPENSDSGTGKKEKEKKNRKGKDKENGSVSSSETPPPPPPPNEINPPPHTMEEEEDDDWGEDTTEE
AQRRRMDEISDHAKVLTLSDDLERTIEERVNILFDFVKKKKEEGVIDSSDKEIVAEAERLDVKAMGPLVL
TEVLFNEKIREQIKKYRRHFLRFCHNNKKAKRYLLHGLECVVAMHQAQLISKIPHILKEMYDADLLEEEV
IISWSEKASKKYVSKELAKEIRVKAEPFIKWLKEAEEESSGGEEEDEDENIEVVYSKAASVPKVETVKSD
NKDDDIDIDAI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001960
RefSeq Size 5963
RefSeq ORF 1293
Synonyms EIF-5; EIF-5A
Locus ID 1983
UniProt ID P55010
Cytogenetics 14q32.32
Summary Eukaryotic translation initiation factor-5 (EIF5) interacts with the 40S initiation complex to promote hydrolysis of bound GTP with concomitant joining of the 60S ribosomal subunit to the 40S initiation complex. The resulting functional 80S ribosomal initiation complex is then active in peptidyl transfer and chain elongations (summary by Si et al., 1996 PubMed 8663286).supplied by OMIM, May 2010
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "EIF5" proteins (5)
SKU Description Size Price
LC405302 Lyophilized EIF5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC419615 Lyophilized EIF5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405302 Transient overexpression lysate of eukaryotic translation initiation factor 5 (EIF5), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY419615 Transient overexpression lysate of eukaryotic translation initiation factor 5 (EIF5), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP306301 Recombinant protein of human eukaryotic translation initiation factor 5 (EIF5), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products