OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ZDHHC2 (NM_016353) Human Mass Spec Standard

Be the first to review this product
SKU
PH306263
ZDHHC2 MS Standard C13 and N15-labeled recombinant protein (NP_057437)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA315449 Rabbit polyclonal anti-ZDHHC2 antibody
100 ul
$380.00
LY414028 Transient overexpression lysate of zinc finger, DHHC-type containing 2 (ZDHHC2) (as WB positive control) 100 ug
$436.00

Other products for "ZDHHC2 or NM_016353"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206263
Predicted MW 42 kDa
Protein Sequence
Protein Sequence
>RC206263 protein sequence
Red=Cloning site Green=Tags(s)

MAPSGPGSSARRRCRRVLYWIPVVFITLLLGWSYYAYAIQLCIVSMENTGEQVVCLMAYHLLFAMFVWSY
WKTIFTLPMNPSKEFHLSYAEKDLLEREPRGEAHQEVLRRAAKDLPIYTRTMSGAIRYCDRCQLIKPDRC
HHCSVCDKCILKMDHHCPWVNNCVGFSNYKFFLLFLAYSLLYCLFIAATDLQYFIKFWTNGLPDTQAKFH
IMFLFFAAAMFSVSLSSLFGYHCWLVSKNKSTLEAFRSPVFRHGTDKNGFSLGFSKNMRQVFGDEKKYWL
LPIFSSLGDGCSFPTCLVNQDPEQASTPAGLNSTAKNLENHQFPAKPLRESQSHLLTDSQSWTESSINPG
KCKAGMSNPALTMENET

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057437
RefSeq Size 4012
RefSeq ORF 1101
Synonyms DHHC2; ZNF372
Locus ID 51201
UniProt ID Q9UIJ5
Cytogenetics 8p22
Summary Palmitoyltransferase specific for GAP43 and DLG4/PSD95.UniProtKB/Swiss-Prot Function
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ZDHHC2" proteins (3)
SKU Description Size Price
LC414028 Lyophilized ZDHHC2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414028 Transient overexpression lysate of zinc finger, DHHC-type containing 2 (ZDHHC2) (as WB positive control) 100 ug
$436.00
TP306263 Recombinant protein of human zinc finger, DHHC-type containing 2 (ZDHHC2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products