ZDHHC2 (NM_016353) Human Recombinant Protein

SKU
TP306263
Recombinant protein of human zinc finger, DHHC-type containing 2 (ZDHHC2), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC206263 protein sequence
Red=Cloning site Green=Tags(s)

MAPSGPGSSARRRCRRVLYWIPVVFITLLLGWSYYAYAIQLCIVSMENTGEQVVCLMAYHLLFAMFVWSY
WKTIFTLPMNPSKEFHLSYAEKDLLEREPRGEAHQEVLRRAAKDLPIYTRTMSGAIRYCDRCQLIKPDRC
HHCSVCDKCILKMDHHCPWVNNCVGFSNYKFFLLFLAYSLLYCLFIAATDLQYFIKFWTNGLPDTQAKFH
IMFLFFAAAMFSVSLSSLFGYHCWLVSKNKSTLEAFRSPVFRHGTDKNGFSLGFSKNMRQVFGDEKKYWL
LPIFSSLGDGCSFPTCLVNQDPEQASTPAGLNSTAKNLENHQFPAKPLRESQSHLLTDSQSWTESSINPG
KCKAGMSNPALTMENET

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 41.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_057437
Locus ID 51201
UniProt ID Q9UIJ5
Cytogenetics 8p22
RefSeq Size 4012
RefSeq ORF 1101
Synonyms DHHC2; ZNF372
Summary Palmitoyltransferase specific for GAP43 and DLG4/PSD95.[UniProtKB/Swiss-Prot Function]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:ZDHHC2 (NM_016353) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH306263 ZDHHC2 MS Standard C13 and N15-labeled recombinant protein (NP_057437) 10 ug
$3,255.00
LC414028 ZDHHC2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414028 Transient overexpression lysate of zinc finger, DHHC-type containing 2 (ZDHHC2) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.