SH3BGRL2 (NM_031469) Human Mass Spec Standard

CAT#: PH306241

SH3BGRL2 MS Standard C13 and N15-labeled recombinant protein (NP_113657)

Product Images

Coomassie blue staining of purified SH3BGRL2 protein (Cat# TP306241). The protein was produced from HEK293T cells transfected with SH3BGRL2 cDNA clone (Cat# RC206241) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206241
• Predicted MW: 12.1 kDa
• Protein Sequence:
  Sequence Link

  >RC206241 representing NM_031469
  Red=Cloning site Green=Tags(s)
  
  MVIRVFIASSSGFVAIKKKQQDVVRFLEANKIEFEEVDITMSEEQRQWMYKNVPPEKKPTQGNPLPPQIF
  NGDRYCGDYDSFFESKESNTVFSFLGLKPRLASKAEP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_113657
• RefSeq Size: 4676
• RefSeq ORF: 321
• Locus ID: 83699
• UniProt ID: Q9UJC5
• Cytogenetics: 6q14.1