TCTE1 (NM_182539) Human Mass Spec Standard

CAT#: PH306214

TCTE1 MS Standard C13 and N15-labeled recombinant protein (NP_872345)

Product Images

Coomassie blue staining of purified TCTE1 protein (Cat# TP306214). The protein was produced from HEK293T cells transfected with TCTE1 cDNA clone (Cat# RC206214) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206214
• Predicted MW: 55.7 kDa
• Protein Sequence:
  Sequence Link

  >RC206214 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MQDTVTTSALLDPSHSSVSTQDNSSTGGHTSSTSLQLSKPSITPVPAKSRNPRPRANIRRMRRIIAEDPE
  WSLAIVPLLTELCIQHIIRNFQKNPILKQMLPEHQQKVLNHLSPDLPLAVTANLIDSENYWLRCCMHRWP
  VCHVAHHGGSWKRMFFERHLENLLKHFIPGTTDPAVILDLLPLCRNYVRRVHVDQFLPPVQLPAQLRPGD
  QSDSGSEGEMEEPTVDHYQLGDLVAGLSHLEELDLVYDVKDCGMNFEWNLFLFTYRDCLSLAAAIKACHT
  LKIFKLTRSKVDDDKARIIIRSLLDHPVLEELDLSQNLIGDRGARGAAKLLSHSRLRVLNLANNQVRAPG
  AQSLAHALAHNTNLISLNLRLNCIEDEGGQALAHALQTNKCLTTLHLGGNELSEPTATLLSQVLAINTTL
  TSINLSCNHIGLDGGKQLLEGMSDNKTLLEFDLRLSDVAQESEYLIGQALYANREAARQRALNPSHFMST
  ITANGPENSVG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_872345
• RefSeq Size: 1686
• RefSeq ORF: 1503
• Synonyms: D6S46; DRC5; FAP155
• Locus ID: 202500
• UniProt ID: Q5JU00
• Cytogenetics: 6p21.1
• Summary: Component of the nexin-dynein regulatory complex (N-DRC) a key regulator of ciliary/flagellar motility which maintains the alignment and integrity of the distal axoneme and regulates microtubule sliding in motile axonemes. May play a role in the assembly of N-DRC. May be required for sperm motility.[UniProtKB/Swiss-Prot Function]