OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EGLN2 (NM_053046) Human Mass Spec Standard

Be the first to review this product
SKU
PH306152
EGLN2 MS Standard C13 and N15-labeled recombinant protein (NP_444274)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA808584 EGLN2 mouse monoclonal antibody, clone OTI7H3 (formerly 7H3) 100 ul
$447.00
LY409048 Transient overexpression lysate of egl nine homolog 2 (C. elegans) (EGLN2), transcript variant 3 (as WB positive control) 100 ug
$436.00

Other products for "EGLN2 or NM_053046"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206152
Predicted MW 43.7 kDa
Protein Sequence
Protein Sequence
>RC206152 protein sequence
Red=Cloning site Green=Tags(s)

MDSPCQPQPLSQALPQLPGSSSEPLEPEPGRARMGVESYLPCPLLPSYHCPGVPSEASAGSGTPRATATS
TTASPLRDGFGGQDGGELRPLQSEGAAALVTKGCQRLAAQGARPEAPKRKWAEDGGDAPSPSKRPWARQE
NQEAEREGGMSCSCSSGSGEASAGLMEEALPSAPERLALDYIVPCMRYYGICVKDSFLGAALGGRVLAEV
EALKRGGRLRDGQLVSQRAIPPRSIRGDQIAWVEGHEPGCRSIGALMAHVDAVIRHCAGRLGSYVINGRT
KAMVACYPGNGLGYVRHVDNPHGDGRCITCIYYLNQNWDVKVHGGLLQIFPEGRPVVANIEPLFDRLLIF
WSDRRNPHEVKPAYATRYAITVWYFDAKERAAAKDKYQLASGQKGVQVPVSQPPTPT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_444274
RefSeq Size 2264
RefSeq ORF 1221
Synonyms EIT-6; EIT6; HIF-PH1; HIFPH1; HPH-1; HPH-3; PHD1
Locus ID 112398
UniProt ID Q96KS0
Cytogenetics 19q13.2
Summary The hypoxia inducible factor (HIF) is a transcriptional complex that is involved in oxygen homeostasis. At normal oxygen levels, the alpha subunit of HIF is targeted for degration by prolyl hydroxylation. This gene encodes an enzyme responsible for this post-translational modification. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the upstream RAB4B (RAB4B, member RAS oncogene family) gene. provided by RefSeq, Feb 2011
Protein Families Druggable Genome
Protein Pathways Pathways in cancer, Renal cell carcinoma
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "EGLN2" proteins (6)
SKU Description Size Price
LC403281 Lyophilized EGLN2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC409048 Lyophilized EGLN2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403281 Transient overexpression lysate of egl nine homolog 2 (C. elegans) (EGLN2), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY409048 Transient overexpression lysate of egl nine homolog 2 (C. elegans) (EGLN2), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP306152 Recombinant protein of human egl nine homolog 2 (C. elegans) (EGLN2), transcript variant 1, 20 µg 20 ug
$737.00
TP760370 Purified recombinant protein of Human egl nine homolog 2 (C. elegans) (EGLN2), transcript variant 3, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products