OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ELMOD1 (NM_018712) Human Mass Spec Standard

Be the first to review this product
SKU
PH306126
ELMOD1 MS Standard C13 and N15-labeled recombinant protein (NP_061182)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA344839 Rabbit Polyclonal Anti-ELMOD1 Antibody - N-terminal region
100 ul
$585.00
LY412885 Transient overexpression lysate of ELMO/CED-12 domain containing 1 (ELMOD1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "ELMOD1 or NM_018712"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206126
Predicted MW 39.1 kDa
Protein Sequence
Protein Sequence
>RC206126 protein sequence
Red=Cloning site Green=Tags(s)

MKHFLRMLIQVCLYFYCKFLWRCLKFVMRKLTGRCELQRICYNTKPGASRTMKIETSLRDSKSKLLQTSV
SVHPDAIEKTIEDIMELKKINPDVNPQLGISLQACLLQIVGYRNLIADVEKLRREAYDSDNPQHEEMLLK
LWKFLKPNTPLESRISKQWCEIGFQGDDPKTDFRGMGLLGLYNLQYFAERDATAAQQVLSDSLHPKCRDI
TKEEISKFSKAEWEKKRMDKAIGYSFAIVGINITDLAYNLLVSGALKTHFYNIAPEAPTLSHFQQTFCYL
MHEFHKFWIEEDPMDIMEFNRVREKFRKRIIKQLQNPDMALCPHFAASEGLINM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_061182
RefSeq Size 3006
RefSeq ORF 1002
Locus ID 55531
UniProt ID Q8N336
Cytogenetics 11q22.3
Summary Acts as a GTPase-activating protein (GAP) toward guanine nucleotide exchange factors like ARL2, ARL3, ARF1 and ARF6, but not for GTPases outside the Arf family.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ELMOD1" proteins (5)
SKU Description Size Price
LC412885 Lyophilized ELMOD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427120 Lyophilized ELMOD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412885 Transient overexpression lysate of ELMO/CED-12 domain containing 1 (ELMOD1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY427120 Transient overexpression lysate of ELMO/CED-12 domain containing 1 (ELMOD1), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP306126 Recombinant protein of human ELMO/CED-12 domain containing 1 (ELMOD1), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products