OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GTSF1 (NM_144594) Human Mass Spec Standard

Be the first to review this product
SKU
PH306099
GTSF1 MS Standard C13 and N15-labeled recombinant protein (NP_653195)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA376873 GTSF1 Rabbit polyclonal Antibody
100 ul
$410.00
LY408235 Transient overexpression lysate of gametocyte specific factor 1 (GTSF1) (as WB positive control) 100 ug
$436.00

Other products for "GTSF1 or NM_144594"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206099
Predicted MW 19.2 kDa
Protein Sequence
Protein Sequence
>RC206099 protein sequence
Red=Cloning site Green=Tags(s)

MEETYTDSLDPEKLLQCPYDKNHQIRACRFPYHLIKCRKNHPDVASKLATCPFNARHQVPRAEISHHISS
CDDRSCIEQDVVNQTRSLRQETLAESTWQCPPCDEDWDKDLWEQTSTPFAWGTTHYSDNNSPASNIVTEH
KNNLASGMRVPKSLPYVLPWKNNGNAQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_653195
RefSeq Size 822
RefSeq ORF 501
Synonyms Cue110; FAM112B
Locus ID 121355
UniProt ID Q8WW33
Cytogenetics 12q13.13
Summary Required for spermatogenesis and is involved in the suppression of retrotransposon transcription in male germ cells.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GTSF1" proteins (3)
SKU Description Size Price
LC408235 Lyophilized GTSF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408235 Transient overexpression lysate of gametocyte specific factor 1 (GTSF1) (as WB positive control) 100 ug
$436.00
TP306099 Recombinant protein of human gametocyte specific factor 1 (GTSF1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products