OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MAGEB4 (NM_002367) Human Mass Spec Standard

Be the first to review this product
SKU
PH306060
MAGEB4 MS Standard C13 and N15-labeled recombinant protein (NP_002358)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA809226 MAGEB4 mouse monoclonal antibody,clone OTI1B5 100 ul
$447.00
LY419379 Transient overexpression lysate of melanoma antigen family B, 4 (MAGEB4) (as WB positive control) 100 ug
$436.00

Other products for "MAGEB4 or NM_002367"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206060
Predicted MW 39 kDa
Protein Sequence
Protein Sequence
>RC206060 protein sequence
Red=Cloning site Green=Tags(s)

MPRGQKSKLRAREKRQRTRGQTQDLKVGQPTAAEKEESPSPSSSVLRDTASSSLAFGIPQEPQREPPTTS
AAAAMSCTGSDKGDESQDEENASSSQASTSTERSLKDSLTRKTKMLVQFLLYKYKMKEPTTKAEMLKIIS
KKYKEHFPEIFRKVSQRTELVFGLALKEVNPTTHSYILVSMLGPNYGNQSSAWTLPRNGLLMPLLSVIFL
NGNCAREEEIWEFLNMLGIYDGKRHLIFGEPRKLITQDLVQEKYLEYQQVPNSDPPRYQFLWGPRAHAET
SKMKVLEFLAKVNDTTPNNFPLLYEEALRDEEERAGARPRVAARRGTTAMTSAYSRATSSSSSQPM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002358
RefSeq Size 2266
RefSeq ORF 1038
Synonyms CT3.6
Locus ID 4115
UniProt ID O15481
Cytogenetics Xp21.2
Summary This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other. The promoters and first exons of the MAGEB genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEB genes are clustered on chromosome Xp22-p21. This gene sequence ends in the first intron of MAGEB1, another family member. This gene is expressed in testis. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MAGEB4" proteins (3)
SKU Description Size Price
LC419379 Lyophilized MAGEB4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419379 Transient overexpression lysate of melanoma antigen family B, 4 (MAGEB4) (as WB positive control) 100 ug
$436.00
TP306060 Recombinant protein of human melanoma antigen family B, 4 (MAGEB4), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products