BMPR1A (NM_004329) Human Mass Spec Standard

CAT#: PH306048

BMPR1A MS Standard C13 and N15-labeled recombinant protein (NP_004320)

Product Images

Coomassie blue staining of purified BMPR1A protein (Cat# TP306048). The protein was produced from HEK293T cells transfected with BMPR1A cDNA clone (Cat# RC206048) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206048
• Predicted MW: 60.2 kDa
• Protein Sequence:
  Sequence Link

  >RC206048 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPQLYIYIRLLGAYLFIISRVQGQNLDSMLHGTGMKSDSDQKKSENGVTLAPEDTLPFLKCYCSGHCPDD
  AINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPP
  VVIGPFFDGSIRWLVLLISMAVCIIAMIIFSSCFCYKHYCKSISSRRRYNRDLEQDEAFIPVGESLKDLI
  DQSQSSGSGSGLPLLVQRTIAKQIQMVRQVGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQT
  VLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDFLKCATLDTRALLKLAYSAACGLCHLHTEIY
  GTQGKPAIAHRDLKSKNILIKKNGSCCIADLGLAVKFNSDTNEVDVPLNTRVGTKRYMAPEVLDESLNKN
  HFQPYIMADIYSFGLIIWEMARRCITGGIVEEYQLPYYNMVPSDPSYEDMREVVCVKRLRPIVSNRWNSD
  ECLRAVLKLMSECWAHNPASRLTALRIKKTLAKMVESQDVKI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004320
• RefSeq Size: 3631
• RefSeq ORF: 1596
• Synonyms: 10q23del; ACVRLK3; ALK3; CD292; SKR5
• Locus ID: 657
• UniProt ID: P36894
• Cytogenetics: 10q23.2
• Summary: The bone morphogenetic protein (BMP) receptors are a family of transmembrane serine/threonine kinases that include the type I receptors BMPR1A and BMPR1B and the type II receptor BMPR2. These receptors are also closely related to the activin receptors, ACVR1 and ACVR2. The ligands of these receptors are members of the TGF-beta superfamily. TGF-betas and activins transduce their signals through the formation of heteromeric complexes with 2 different types of serine (threonine) kinase receptors: type I receptors of about 50-55 kD and type II receptors of about 70-80 kD. Type II receptors bind ligands in the absence of type I receptors, but they require their respective type I receptors for signaling, whereas type I receptors require their respective type II receptors for ligand binding. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Protein Kinase, Transmembrane
• Protein Pathways: Cytokine-cytokine receptor interaction, TGF-beta signaling pathway