OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EXOSC1 (NM_016046) Human Mass Spec Standard

Be the first to review this product
SKU
PH306007
EXOSC1 MS Standard C13 and N15-labeled recombinant protein (NP_057130)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA808518 EXOSC1 mouse monoclonal antibody, clone OTI1H9 (formerly 1H9) 100 ul
$447.00
LY414227 Transient overexpression lysate of exosome component 1 (EXOSC1) (as WB positive control) 100 ug
$436.00

Other products for "EXOSC1 or NM_016046"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206007
Predicted MW 21.5 kDa
Protein Sequence
Protein Sequence
>RC206007 protein sequence
Red=Cloning site Green=Tags(s)

MAPPVRYCIPGERLCNLEEGSPGSGTYTRHGYIFSSLAGCLMKSSENGALPVVSVVRETESQLLPDVGAI
VTCKVSSINSRFAKVHILYVGSMPLKNSFRGTIRKEDVRATEKDKVEIYKSFRPGDIVLAKVISLGDAQS
NYLLTTAENELGVVVAHSESGIQMVPISWCEMQCPKTHTKEFRKVARVQPEFLQT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057130
RefSeq Size 1150
RefSeq ORF 585
Synonyms CGI-108; CSL4; Csl4p; p13; PCH1F; SKI4; Ski4p
Locus ID 51013
UniProt ID Q9Y3B2
Cytogenetics 10q24.1
Summary This gene encodes a core component of the exosome. The mammalian exosome is required for rapid degradation of AU rich element-containing RNAs but not for poly(A) shortening. The association of this protein with the exosome is mediated by protein-protein interactions with ribosomal RNA-processing protein 42 and ribosomal RNA-processing protein 46. Alternative splicing of this gene results in multiple transcript variants. provided by RefSeq, Jan 2016
Protein Pathways RNA degradation
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "EXOSC1" proteins (3)
SKU Description Size Price
LC414227 Lyophilized EXOSC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414227 Transient overexpression lysate of exosome component 1 (EXOSC1) (as WB positive control) 100 ug
$436.00
TP306007 Recombinant protein of human exosome component 1 (EXOSC1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products