OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Nudel (NDEL1) (NM_030808) Human Mass Spec Standard

Be the first to review this product
SKU
PH305974
NDEL1 MS Standard C13 and N15-labeled recombinant protein (NP_110435)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA503353 NDEL1 (Nudel ) mouse monoclonal antibody, clone OTI5E11 (formerly 5E11) 100 ul
$447.00
LY410703 Transient overexpression lysate of nudE nuclear distribution gene E homolog (A. nidulans)-like 1 (NDEL1), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "Nudel or NM_030808"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205974
Predicted MW 38.4 kDa
Protein Sequence
Protein Sequence
>RC205974 protein sequence
Red=Cloning site Green=Tags(s)

MDGEDIPDFSSLKEETAYWKELSLKYKQSFQEARDELVEFQEGSRELEAELEAQLVQAEQRNRDLQADNQ
RLKYEVEALKEKLEHQYAQSYKQVSVLEDDLSQTRAIKEQLHKYVRELEQANDDLERAKRATIVSLEDFE
QRLNQAIERNAFLESELDEKESLLVSVQRLKDEARDLRQELAVRERQQEVTRKSAPSSPTLDCEKMDSAV
QASLSLPATPVGKGTENTFPSPKAIPNGFGTSPLTPSARISALNIVGDLLRKVGALESKLAACRNFAKDQ
ASRKSYISGNVNCGVLNGNGTKFSRSGHTSFFDKGAVNGFDTAPPPPGLGSSRPSSAPGMLPLSV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_110435
RefSeq Size 2407
RefSeq ORF 1035
Synonyms EOPA; MITAP1; NDE1L1; NDE2; NUDEL
Locus ID 81565
UniProt ID Q9GZM8
Cytogenetics 17p13.1
Summary This gene encodes a coiled-coil protein that plays a role in multiple processes including cytoskeletal organization, cell signaling and neuron migration, outgrowth and maintenance. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome X. provided by RefSeq, Mar 2012
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Nudel" proteins (7)
SKU Description Size Price
PH312323 NDEL1 MS Standard C13 and N15-labeled recombinant protein (NP_001020750) 10 ug
$3,360.00
LC410703 Lyophilized NDEL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422448 Lyophilized NDEL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410703 Transient overexpression lysate of nudE nuclear distribution gene E homolog (A. nidulans)-like 1 (NDEL1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY422448 Transient overexpression lysate of nudE nuclear distribution gene E homolog (A. nidulans)-like 1 (NDEL1), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP305974 Recombinant protein of human nudE nuclear distribution gene E homolog (A. nidulans)-like 1 (NDEL1), transcript variant 2, 20 µg 20 ug
$737.00
TP312323 Recombinant protein of human nudE nuclear distribution gene E homolog (A. nidulans)-like 1 (NDEL1), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products