Nudel (NDEL1) (NM_001025579) Human Mass Spec Standard

SKU
PH312323
NDEL1 MS Standard C13 and N15-labeled recombinant protein (NP_001020750)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC212323]
Predicted MW 36.9 kDa
Protein Sequence
Protein Sequence
>RC212323 representing NM_001025579
Red=Cloning site Green=Tags(s)

MDGEDIPDFSSLKEETAYWKELSLKYKQSFQEARDELVEFQEGSRELEAELEAQLVQAEQRNRDLQADNQ
RLKYEVEALKEKLEHQYAQSYKQVSVLEDDLSQTRAIKEQLHKYVRELEQANDDLERAKRATIVSLEDFE
QRLNQAIERNAFLESELDEKESLLVSVQRLKDEARDLRQELAVRERQQEVTRKSAPSSPTLDCEKMDSAV
QASLSLPATPVGKGTENTFPSPKAIPNGFGTSPLTPSARISALNIVGDLLRKVGALESKLAACRNFAKDQ
ASRKSYISGNVNCGVLNGNGTKFSRSGHTSFFDKGQEKVIFPTLFMGQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001020750
RefSeq Size 2420
RefSeq ORF 984
Synonyms EOPA; MITAP1; NDE1L1; NDE2; NUDEL
Locus ID 81565
UniProt ID Q9GZM8
Cytogenetics 17p13.1
Summary This gene encodes a coiled-coil protein that plays a role in multiple processes including cytoskeletal organization, cell signaling and neuron migration, outgrowth and maintenance. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome X. [provided by RefSeq, Mar 2012]
Write Your Own Review
You're reviewing:Nudel (NDEL1) (NM_001025579) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH305974 NDEL1 MS Standard C13 and N15-labeled recombinant protein (NP_110435) 10 ug
$3,255.00
LC410703 NDEL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422448 NDEL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410703 Transient overexpression lysate of nudE nuclear distribution gene E homolog (A. nidulans)-like 1 (NDEL1), transcript variant 2 100 ug
$436.00
LY422448 Transient overexpression lysate of nudE nuclear distribution gene E homolog (A. nidulans)-like 1 (NDEL1), transcript variant 1 100 ug
$436.00
TP305974 Recombinant protein of human nudE nuclear distribution gene E homolog (A. nidulans)-like 1 (NDEL1), transcript variant 2, 20 µg 20 ug
$737.00
TP312323 Recombinant protein of human nudE nuclear distribution gene E homolog (A. nidulans)-like 1 (NDEL1), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.