OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CRIP2 (NM_001312) Human Mass Spec Standard

Be the first to review this product
SKU
PH305938
CRIP2 MS Standard C13 and N15-labeled recombinant protein (NP_001303)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA335870 Rabbit Polyclonal Anti-CRIP2 Antibody
100 ul
$585.00
LY420019 Transient overexpression lysate of cysteine-rich protein 2 (CRIP2) (as WB positive control) 100 ug
$436.00

Other products for "CRIP2 or NM_001312"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205938
Predicted MW 22.5 kDa
Protein Sequence
Protein Sequence
>RC205938 protein sequence
Red=Cloning site Green=Tags(s)

MASKCPKCDKTVYFAEKVSSLGKDWHKFCLKCERCSKTLTPGGHAEHDGKPFCHKPCYATLFGPKGVNIG
GAGSYIYEKPLAEGPQVTGPIEVPAARAEERKASGPPKGPSRASSVTTFTGEPNTCPRCSKKVYFAEKVT
SLGKDWHRPCLRCERCGKTLTPGGHAEHDGQPYCHKPCYGILFGPKGVNTGAVGSYIYDRDPEGKVQP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001303
RefSeq Size 1247
RefSeq ORF 624
Synonyms CRIP; CRP2; ESP1
Locus ID 1397
UniProt ID P52943
Cytogenetics 14q32.33
Summary This gene encodes a putative transcription factor with two LIM zinc-binding domains. The encoded protein may participate in the differentiation of smooth muscle tissue. Alternative splicing results in multiple transcript variants. provided by RefSeq, Aug 2012
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CRIP2" proteins (3)
SKU Description Size Price
LC420019 Lyophilized CRIP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY420019 Transient overexpression lysate of cysteine-rich protein 2 (CRIP2) (as WB positive control) 100 ug
$436.00
TP305938 Recombinant protein of human cysteine-rich protein 2 (CRIP2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products