OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SMYD3 (NM_022743) Human Mass Spec Standard

Be the first to review this product
SKU
PH305933
SMYD3 MS Standard C13 and N15-labeled recombinant protein (NP_073580)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA381806 SMYD3 Rabbit polyclonal Antibody
100 ul
$410.00
LY402935 Transient overexpression lysate of SET and MYND domain containing 3 (SMYD3), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "SMYD3 or NM_022743"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205933
Predicted MW 49.1 kDa
Protein Sequence
Protein Sequence
>RC205933 protein sequence
Red=Cloning site Green=Tags(s)

MEPLKVEKFATANRGNGLRAVTPLRPGELLFRSDPLAYTVCKGSRGVVCDRCLLGKEKLMRCSQCRVAKY
CSAKCQKKAWPDHKRECKCLKSCKPRYPPDSVRLLGRVVFKLMDGAPSESEKLYSFYDLESNINKLTEDR
KEGLRQLVMTFQHFMREEIQDASQLPPAFDLFEAFAKVICNSFTICNAEMQEVGVGLYPSISLLNHSCDP
NCSIVFNGPHLLLRAVRDIEVGEELTICYLDMLMTSEERRKQLRDQYCFECDCFRCQTQDKDADMLTGDE
QVWKEVQESLKKIEELKAHWKWEQVLAMCQAIISSNSERLPDINIYQLKVLDCAMDACINLGLLEEALFY
GTRTMEPYRIFFPGSHPVRGVQVMKVGKLQLHQGMFPQAMKNLRLAFDIMRVTHGREHSLIEDLILLLEE
CDANIRAS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_073580
RefSeq Size 1469
RefSeq ORF 1284
Synonyms bA74P14.1; KMT3E; ZMYND1; ZNFN3A1
Locus ID 64754
UniProt ID Q9H7B4
Cytogenetics 1q44
Summary This gene encodes a histone methyltransferase which functions in RNA polymerase II complexes by an interaction with a specific RNA helicase. Multiple transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Dec 2011
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SMYD3" proteins (3)
SKU Description Size Price
LC402935 Lyophilized SMYD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402935 Transient overexpression lysate of SET and MYND domain containing 3 (SMYD3), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP305933 Recombinant protein of human SET and MYND domain containing 3 (SMYD3), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products