OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CLIC5 (NM_016929) Human Mass Spec Standard

Be the first to review this product
SKU
PH305906
CLIC5 MS Standard C13 and N15-labeled recombinant protein (NP_058625)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY402589 Transient overexpression lysate of chloride intracellular channel 5 (CLIC5), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "CLIC5 or NM_016929"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205906
Predicted MW 28.2 kDa
Protein Sequence
Protein Sequence
>RC205906 protein sequence
Red=Cloning site Green=Tags(s)

MTDSATANGDDRDPEIELFVKAGIDGESIGNCPFSQRLFMILWLKGVVFNVTTVDLKRKPADLHNLAPGT
HPPFLTFNGDVKTDVNKIEEFLEETLTPEKYPKLAAKHRESNTAGIDIFSKFSAYIKNTKQQNNAALERG
LTKALKKLDDYLNTPLPEEIDANTCGEDKGSRRKFLDGDELTLADCNLLPKLHVVKIVAKKYRNYDIPAE
MTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_058625
RefSeq Size 5752
RefSeq ORF 753
Synonyms DFNB102; DFNB103; MST130; MSTP130
Locus ID 53405
UniProt ID Q9NZA1
Cytogenetics 6p21.1
Summary This gene encodes a member of the chloride intracellular channel (CLIC) family of chloride ion channels. The encoded protein associates with actin-based cytoskeletal structures and may play a role in multiple processes including hair cell stereocilia formation, myoblast proliferation and glomerular podocyte and endothelial cell maintenance. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. provided by RefSeq, Dec 2011
Protein Families Druggable Genome, Ion Channels: Other
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CLIC5" proteins (6)
SKU Description Size Price
LC402589 Lyophilized CLIC5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426442 Lyophilized CLIC5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402589 Transient overexpression lysate of chloride intracellular channel 5 (CLIC5), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY426442 Transient overexpression lysate of chloride intracellular channel 5 (CLIC5), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP305906 Recombinant protein of human chloride intracellular channel 5 (CLIC5), transcript variant 2, 20 µg 20 ug
$867.00
TP720188 Recombinant protein of human chloride intracellular channel 5 (CLIC5), transcript variant 1 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products