OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CYB5R1 (NM_016243) Human Mass Spec Standard

Be the first to review this product
SKU
PH305833
CYB5R1 MS Standard C13 and N15-labeled recombinant protein (NP_057327)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA504564 CYB5R1 mouse monoclonal antibody, clone OTI4B7 (formerly 4B7) 100 ul
$447.00
LY402525 Transient overexpression lysate of cytochrome b5 reductase 1 (CYB5R1) (as WB positive control) 100 ug
$436.00

Other products for "CYB5R1 or NM_016243"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205833
Predicted MW 34.1 kDa
Protein Sequence
Protein Sequence
>RC205833 protein sequence
Red=Cloning site Green=Tags(s)

MGIQTSPVLLASLGVGLVTLLGLAVGSYLVRRSRRPQVTLLDPNEKYLLRLLDKTTVSHNTKRFRFALPT
AHHTLGLPVGKHIYLSTRIDGSLVIRPYTPVTSDEDQGYVDLVIKVYLKGVHPKFPEGGKMSQYLDSLKV
GDVVEFRGPSGLLTYTGKGHFNIQPNKKSPPEPRVAKKLGMIAGGTGITPMLQLIRAILKVPEDPTQCFL
LFANQTEKDIILREDLEELQARYPNRFKLWFTLDHPPKDWAYSKGFVTADMIREHLPAPGDDVLVLLCGP
PPMVQLACHPNLDKLGYSQKMRFTY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057327
RefSeq Size 1675
RefSeq ORF 915
Synonyms B5R.1; B5R1; B5R2; humb5R2; NQO3A2
Locus ID 51706
UniProt ID Q9UHQ9
Cytogenetics 1q32.1
Summary NADH-cytochrome b5 reductases are involved in desaturation and elongation of fatty acids, cholesterol biosynthesis, drug metabolism, and, in erythrocyte, methemoglobin reduction.UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome, Transmembrane
Protein Pathways Amino sugar and nucleotide sugar metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CYB5R1" proteins (3)
SKU Description Size Price
LC402525 Lyophilized CYB5R1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402525 Transient overexpression lysate of cytochrome b5 reductase 1 (CYB5R1) (as WB positive control) 100 ug
$436.00
TP305833 Recombinant protein of human cytochrome b5 reductase 1 (CYB5R1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products