CYB5R1 (NM_016243) Human Recombinant Protein

SKU
TP305833
Recombinant protein of human cytochrome b5 reductase 1 (CYB5R1), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC205833 protein sequence
Red=Cloning site Green=Tags(s)

MGIQTSPVLLASLGVGLVTLLGLAVGSYLVRRSRRPQVTLLDPNEKYLLRLLDKTTVSHNTKRFRFALPT
AHHTLGLPVGKHIYLSTRIDGSLVIRPYTPVTSDEDQGYVDLVIKVYLKGVHPKFPEGGKMSQYLDSLKV
GDVVEFRGPSGLLTYTGKGHFNIQPNKKSPPEPRVAKKLGMIAGGTGITPMLQLIRAILKVPEDPTQCFL
LFANQTEKDIILREDLEELQARYPNRFKLWFTLDHPPKDWAYSKGFVTADMIREHLPAPGDDVLVLLCGP
PPMVQLACHPNLDKLGYSQKMRFTY

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 33.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_057327
Locus ID 51706
UniProt ID Q9UHQ9
Cytogenetics 1q32.1
RefSeq Size 1675
RefSeq ORF 915
Synonyms B5R.1; B5R1; B5R2; humb5R2; NQO3A2
Summary NADH-cytochrome b5 reductases are involved in desaturation and elongation of fatty acids, cholesterol biosynthesis, drug metabolism, and, in erythrocyte, methemoglobin reduction.[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome, Transmembrane
Protein Pathways Amino sugar and nucleotide sugar metabolism
Write Your Own Review
You're reviewing:CYB5R1 (NM_016243) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH305833 CYB5R1 MS Standard C13 and N15-labeled recombinant protein (NP_057327) 10 ug
$3,255.00
LC402525 CYB5R1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402525 Transient overexpression lysate of cytochrome b5 reductase 1 (CYB5R1) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.