OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EFHC1 (NM_018100) Human Mass Spec Standard

Be the first to review this product
SKU
PH305830
EFHC1 MS Standard C13 and N15-labeled recombinant protein (NP_060570)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY413316 Transient overexpression lysate of EF-hand domain (C-terminal) containing 1 (EFHC1) (as WB positive control) 100 ug
$436.00

Other products for "EFHC1 or NM_018100"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205830
Predicted MW 73.9 kDa
Protein Sequence
Protein Sequence
>RC205830 protein sequence
Red=Cloning site Green=Tags(s)

MVSNPVHGLPFLPGTSFKDSTKTAFHRSQTLSYRNGYAIVRRPTVGIGGDRLQFNQLSQAELDELASKAP
VLTYGQPKQAPPADFIPAHVAFDKKVLKFDAYFQEDVPMSTEEQYRIRQVNIYYYLEDDSMSVIEPVVEN
SGILQGKLIKRQRLAKNDRGDHYHWKDLNRGINITIYGKTFRVVDCDQFTQVFLESQGIELNPPEKMALD
PYTELRKQPLRKYVTPSDFDQLKQFLTFDKQVLRFYAIWDDTDSMYGECRTYIIHYYLMDDTVEIREVHE
RNDGIDPFPLLMNRQRVPKVLVENAKNFPQCVLEISDQEVLEWYTAKDFIVGKSLTILGRTFFIYDCDPF
TRRYYKEKFGITDLPRIDVSKREPPPVKQELPPYNGFGLVEDSAQNCFALIPKAPKKDVIKMLVNDNKVL
RYLAVLESPIPEDKDRRFVFSYFLATDMISIFEPPVRNSGIIGGKYLGRTKVVKPYSTVDNPVYYGPSDF
FIGAVIEVFGHRFIILDTDEYVLKYMESNAAQYSPEALASIQNHVRKREAPAPEAESKQTEKDPGVQELE
ALIDTIQKQLKDHSCKDNIREAFQIYDKEASGYVDRDMFFKICESLNVPVDDSLVKELLRMCSHGEGKIN
YYNFVRAFSN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060570
RefSeq Size 5596
RefSeq ORF 1920
Synonyms dJ304B14.2; EJM1; POC9; RIB72
Locus ID 114327
UniProt ID Q5JVL4
Cytogenetics 6p12.2
Summary This gene encodes an EF-hand-containing calcium binding protein. The encoded protein likely plays a role in calcium homeostasis. Mutations in this gene have been associated with susceptibility to juvenile myoclonic epilepsy and juvenile absence epilepsy. Alternatively spliced transcript variants have been described. provided by RefSeq, Feb 2010
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "EFHC1" proteins (5)
SKU Description Size Price
LC413316 Lyophilized EFHC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC433359 Lyophilized EFHC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413316 Transient overexpression lysate of EF-hand domain (C-terminal) containing 1 (EFHC1) (as WB positive control) 100 ug
$436.00
LY433359 Transient overexpression lysate of EF-hand domain (C-terminal) containing 1 (EFHC1), transcript variant C (as WB positive control) 100 ug
$436.00
TP305830 Recombinant protein of human EF-hand domain (C-terminal) containing 1 (EFHC1), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products