GPSM3 (NM_022107) Human Mass Spec Standard

CAT#: PH305820

GPSM3 MS Standard C13 and N15-labeled recombinant protein (NP_071390)

Product Images

Coomassie blue staining of purified GPSM3 protein (Cat# TP305820). The protein was produced from HEK293T cells transfected with GPSM3 cDNA clone (Cat# RC205820) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205820
• Predicted MW: 17.9 kDa
• Protein Sequence:
  Sequence Link

  >RC205820 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEAERPQEEEDGEQGPPQDEEGWPPPNSTTRPWRSAPPSPPPPGTRHTALGPRSASLLSLQTELLLDLVA
  EAQSRRLEEQRATFYTPQNPSSLAPAPLRPLEDREQLYSTILSHQCQRMEAQRSEPPLPPGGQELLELLL
  RVQGGGRMEEQRSRPPTHTC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_071390
• RefSeq Size: 1472
• RefSeq ORF: 480
• Synonyms: AGS4; C6orf9; G18; G18.1a; G18.1b; G18.2; NG1
• Locus ID: 63940
• UniProt ID: Q9Y4H4, A0A024RCP6
• Cytogenetics: 6p21.32
• Summary: Interacts with subunit of G(i) alpha proteins and regulates the activation of G(i) alpha proteins.[UniProtKB/Swiss-Prot Function]