CALML3 (NM_005185) Human Mass Spec Standard

CAT#: PH305791

CALML3 MS Standard C13 and N15-labeled recombinant protein (NP_005176)

Product Images

Coomassie blue staining of purified CALML3 protein (Cat# TP305791). The protein was produced from HEK293T cells transfected with CALML3 cDNA clone (Cat# RC205791) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205791
• Predicted MW: 16.9 kDa
• Protein Sequence:
  Sequence Link

  >RC205791 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFL
  GMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYE
  EFVRVLVSK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005176
• RefSeq Size: 1417
• RefSeq ORF: 447
• Synonyms: CLP
• Locus ID: 810
• UniProt ID: P27482
• Cytogenetics: 10p15.1
• Summary: May function as a specific light chain of unconventional myosin-10 (MYO10), also enhances MYO10 translation, possibly by acting as a chaperone for the emerging MYO10 heavy chain protein. May compete with calmodulin by binding, with different affinities, to cellular substrates.[UniProtKB/Swiss-Prot Function]
• Protein Pathways: Alzheimer's disease, Calcium signaling pathway, Glioma, GnRH signaling pathway, Insulin signaling pathway, Long-term potentiation, Melanogenesis, Neurotrophin signaling pathway, Olfactory transduction, Oocyte meiosis, Phosphatidylinositol signaling system, Vascular smooth muscle contraction