OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MARK3 (NM_002376) Human Mass Spec Standard

Be the first to review this product
SKU
PH305758
MARK3 MS Standard C13 and N15-labeled recombinant protein (NP_002367)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY400851 Transient overexpression lysate of MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 3 (as WB positive control) 100 ug
$436.00

Other products for "MARK3 or NM_002376"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205758
Predicted MW 81.4 kDa
Protein Sequence
Protein Sequence
>RC205758 protein sequence
Red=Cloning site Green=Tags(s)

MSTRTPLPTVNERDTENHTSHGDGRQEVTSRTSRSGARCRNSIASCADEQPHIGNYRLLKTIGKGNFAKV
KLARHILTGREVAIKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLIMEYASGGEV
FDYLVAHGRMKEKEARSKFRQIVSAVQYCHQKRIVHRDLKAENLLLDADMNIKIADFGFSNEFTVGGKLD
TFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDC
ENLLKRFLVLNPIKRGTLEQIMKDRWINAGHEEDELKPFVEPELDISDQKRIDIMVGMGYSQEEIQESLS
KMKYDEITATYLLLGRKSSELDASDSSSSSNLSLAKVRPSSDLNNSTGQSPHHKVQRSVSSSQKQRRYSD
HAGPAIPSVVAYPKRSQTSTADSDLKEDGISSRKSSGSAVGGKGIAPASPMLGNASNPNKADIPERKKSS
TVPSSNTASGGMTRRNTYVCSERTTADRHSVIQNGKENSTIPDQRTPVASTHSISSAATPDRIRFPRGTA
SRSTFHGQPRERRTATYNGPPASPSLSHEATPLSQTRSRGSTNLFSKLTSKLTRSRNVSAEQKDENKEAK
PRSLRFTWSMKTTSSMDPGDMMREIRKVLDANNCDYEQRERFLLFCVHGDGHAENLVQWEMEVCKLPRLS
LNGVRFKRISGTSIAFKNIASKIANELKL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002367
RefSeq Size 3474
RefSeq ORF 2187
Synonyms CTAK1; KP78; Par-1a; PAR1A; VIPB
Locus ID 4140
UniProt ID P27448
Cytogenetics 14q32.32-q32.33
Summary The protein encoded by this gene is activated by phosphorylation and in turn is involved in the phosphorylation of tau proteins MAP2 and MAP4. Several transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Oct 2011
Protein Families Druggable Genome, Protein Kinase
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MARK3" proteins (6)
SKU Description Size Price
LC400851 Lyophilized MARK3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427023 Lyophilized MARK3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400851 Transient overexpression lysate of MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY427023 Transient overexpression lysate of MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 5 (as WB positive control) 100 ug
$436.00
TP305758 Recombinant protein of human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 3, 20 µg 20 ug
$867.00
TP760895 Purified recombinant protein of Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 5, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products