MARK3 (NM_002376) Human Recombinant Protein

SKU
TP305758
Recombinant protein of human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 3, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC205758 protein sequence
Red=Cloning site Green=Tags(s)

MSTRTPLPTVNERDTENHTSHGDGRQEVTSRTSRSGARCRNSIASCADEQPHIGNYRLLKTIGKGNFAKV
KLARHILTGREVAIKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLIMEYASGGEV
FDYLVAHGRMKEKEARSKFRQIVSAVQYCHQKRIVHRDLKAENLLLDADMNIKIADFGFSNEFTVGGKLD
TFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDC
ENLLKRFLVLNPIKRGTLEQIMKDRWINAGHEEDELKPFVEPELDISDQKRIDIMVGMGYSQEEIQESLS
KMKYDEITATYLLLGRKSSELDASDSSSSSNLSLAKVRPSSDLNNSTGQSPHHKVQRSVSSSQKQRRYSD
HAGPAIPSVVAYPKRSQTSTADSDLKEDGISSRKSSGSAVGGKGIAPASPMLGNASNPNKADIPERKKSS
TVPSSNTASGGMTRRNTYVCSERTTADRHSVIQNGKENSTIPDQRTPVASTHSISSAATPDRIRFPRGTA
SRSTFHGQPRERRTATYNGPPASPSLSHEATPLSQTRSRGSTNLFSKLTSKLTRSRNVSAEQKDENKEAK
PRSLRFTWSMKTTSSMDPGDMMREIRKVLDANNCDYEQRERFLLFCVHGDGHAENLVQWEMEVCKLPRLS
LNGVRFKRISGTSIAFKNIASKIANELKL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 81.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_002367
Locus ID 4140
UniProt ID P27448
Cytogenetics 14q32.32-q32.33
RefSeq Size 3474
RefSeq ORF 2187
Synonyms CTAK1; KP78; Par-1a; PAR1A; VIPB
Summary The protein encoded by this gene is activated by phosphorylation and in turn is involved in the phosphorylation of tau proteins MAP2 and MAP4. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]
Protein Families Druggable Genome, Protein Kinase
Write Your Own Review
You're reviewing:MARK3 (NM_002376) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH305758 MARK3 MS Standard C13 and N15-labeled recombinant protein (NP_002367) 10 ug
$3,255.00
LC400851 MARK3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427023 MARK3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400851 Transient overexpression lysate of MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 3 100 ug
$436.00
LY427023 Transient overexpression lysate of MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 5 100 ug
$436.00
TP760895 Purified recombinant protein of Human MAP/microtubule affinity-regulating kinase 3 (MARK3), transcript variant 5, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.