DR1 (NM_001938) Human Mass Spec Standard

CAT#: PH305733

DR1 MS Standard C13 and N15-labeled recombinant protein (NP_001929)

Product Images

Coomassie blue staining of purified DR1 protein (Cat# TP305733). The protein was produced from HEK293T cells transfected with DR1 cDNA clone (Cat# RC205733) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205733
• Predicted MW: 19.4 kDa
• Protein Sequence:
  Sequence Link

  >RC205733 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASSSGNDDDLTIPRAAINKMIKETLPNVRVANDARELVVNCCTEFIHLISSEANEICNKSEKKTISPEH
  VIQALESLGFGSYISEVKEVLQECKTVALKRRKASSRLENLGIPEEELLRQQQELFAKARQQQAELAQQE
  WLQMQQAAQQAQLAAASASASNQAGSSQDEEDDDDI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001929
• RefSeq Size: 3222
• RefSeq ORF: 528
• Synonyms: NC2; NC2-BETA; NC2B; NCB2
• Locus ID: 1810
• UniProt ID: Q01658, Q658N3
• Cytogenetics: 1p22.1
• Summary: This gene encodes a TBP- (TATA box-binding protein) associated phosphoprotein that represses both basal and activated levels of transcription. The encoded protein is phosphorylated in vivo and this phosphorylation affects its interaction with TBP. This protein contains a histone fold motif at the amino terminus, a TBP-binding domain, and a glutamine- and alanine-rich region. The binding of DR1 repressor complexes to TBP-promoter complexes may establish a mechanism in which an altered DNA conformation, together with the formation of higher order complexes, inhibits the assembly of the preinitiation complex and controls the rate of RNA polymerase II transcription. [provided by RefSeq, Jul 2008]
• Protein Families: Transcription Factors