OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DR1 (NM_001938) Human Mass Spec Standard

Be the first to review this product
SKU
PH305733
DR1 MS Standard C13 and N15-labeled recombinant protein (NP_001929)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY419640 Transient overexpression lysate of down-regulator of transcription 1, TBP-binding (negative cofactor 2) (DR1) (as WB positive control) 100 ug
$436.00

Other products for "DR1 or NM_001938"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205733
Predicted MW 19.4 kDa
Protein Sequence
Protein Sequence
>RC205733 protein sequence
Red=Cloning site Green=Tags(s)

MASSSGNDDDLTIPRAAINKMIKETLPNVRVANDARELVVNCCTEFIHLISSEANEICNKSEKKTISPEH
VIQALESLGFGSYISEVKEVLQECKTVALKRRKASSRLENLGIPEEELLRQQQELFAKARQQQAELAQQE
WLQMQQAAQQAQLAAASASASNQAGSSQDEEDDDDI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001929
RefSeq Size 3222
RefSeq ORF 528
Synonyms NC2; NC2-BETA; NC2B; NCB2
Locus ID 1810
UniProt ID Q01658
Cytogenetics 1p22.1
Summary This gene encodes a TBP- (TATA box-binding protein) associated phosphoprotein that represses both basal and activated levels of transcription. The encoded protein is phosphorylated in vivo and this phosphorylation affects its interaction with TBP. This protein contains a histone fold motif at the amino terminus, a TBP-binding domain, and a glutamine- and alanine-rich region. The binding of DR1 repressor complexes to TBP-promoter complexes may establish a mechanism in which an altered DNA conformation, together with the formation of higher order complexes, inhibits the assembly of the preinitiation complex and controls the rate of RNA polymerase II transcription. provided by RefSeq, Jul 2008
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DR1" proteins (3)
SKU Description Size Price
LC419640 Lyophilized DR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419640 Transient overexpression lysate of down-regulator of transcription 1, TBP-binding (negative cofactor 2) (DR1) (as WB positive control) 100 ug
$436.00
TP305733 Recombinant protein of human down-regulator of transcription 1, TBP-binding (negative cofactor 2) (DR1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products