OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RRM2 (NM_001034) Human Mass Spec Standard

Be the first to review this product
SKU
PH305718
RRM2 MS Standard C13 and N15-labeled recombinant protein (NP_001025)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA810548 RRM2 mouse monoclonal antibody,clone OTI1F2 100 ul
$447.00
LY431390 Transient overexpression lysate of ribonucleotide reductase M2 (RRM2), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "RRM2 or NM_001034"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205718
Predicted MW 44.7 kDa
Protein Sequence
Protein Sequence
>RC205718 representing NM_001034
Red=Cloning site Green=Tags(s)

MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDE
PLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWESLKPEERYFISHVLAFFAASDGI
VNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFLFNAIETMPCVKKKADWA
LRWIGDKEATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHL
VHKPSEERVREIIINAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFRVENPFDFM
ENISLEGKTNFFEKRVGEYQRMGVMSSPTENSFTLDADF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001025
RefSeq Size 2500
RefSeq ORF 1167
Synonyms C2orf48; R2; RR2; RR2M
Locus ID 6241
UniProt ID P31350
Cytogenetics 2p25.1
Summary This gene encodes one of two non-identical subunits for ribonucleotide reductase. This reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. Synthesis of the encoded protein (M2) is regulated in a cell-cycle dependent fashion. Transcription from this gene can initiate from alternative promoters, which results in two isoforms that differ in the lengths of their N-termini. Related pseudogenes have been identified on chromosomes 1 and X. provided by RefSeq, Sep 2009
Protein Families Druggable Genome
Protein Pathways Glutathione metabolism, Metabolic pathways, p53 signaling pathway, Purine metabolism, Pyrimidine metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RRM2" proteins (5)
SKU Description Size Price
LC421950 Lyophilized RRM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431390 Lyophilized RRM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY421950 Transient overexpression lysate of ribonucleotide reductase M2 (RRM2), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY431390 Transient overexpression lysate of ribonucleotide reductase M2 (RRM2), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP305718 Recombinant protein of human ribonucleotide reductase M2 polypeptide (RRM2), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products