OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SPDEF (NM_012391) Human Mass Spec Standard

Be the first to review this product
SKU
PH305688
SPDEF MS Standard C13 and N15-labeled recombinant protein (NP_036523)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA324209 Anti-SPDEF Rabbit Polyclonal Antibody
100 ul
$305.00
LY415796 Transient overexpression lysate of SAM pointed domain containing ets transcription factor (SPDEF) (as WB positive control) 100 ug
$436.00

Other products for "SPDEF or NM_012391"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205688
Predicted MW 37.5 kDa
Protein Sequence
Protein Sequence
>RC205688 protein sequence
Red=Cloning site Green=Tags(s)

MGSASPGLSSVSPSHLLLPPDTVSRTGLEKAAAGAVGLERRDWSPSPPATPEQGLSAFYLSYFDMLYPED
SSWAAKAPGASSREEPPEEPEQCPVIDSQAPAGSLDLVPGGLTLEEHSLEQVQSMVVGEVLKDIETACKL
LNITADPMDWSPSNVQKWLLWTEHQYRLPPMGKAFQELAGKELCAMSEEQFRQRSPLGGDVLHAHLDIWK
SAAWMKERTSPGAIHYCASTSEESWTDSEVDSSCSGQPIHLWQFLKELLLKPHSYGRFIRWLNKEKGIFK
IEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLVYQFVHPI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036523
RefSeq Size 1914
RefSeq ORF 1005
Synonyms bA375E1.3; PDEF
Locus ID 25803
UniProt ID O95238
Cytogenetics 6p21.31
Summary The protein encoded by this gene belongs to the ETS family of transcription factors. It is highly expressed in the prostate epithelial cells, and functions as an androgen-independent transactivator of prostate-specific antigen (PSA) promoter. Higher expression of this protein has also been reported in brain, breast, lung and ovarian tumors, compared to the corresponding normal tissues, and it shows better tumor-association than other cancer-associated molecules, making it a more suitable target for developing specific cancer therapies. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Nov 2011
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SPDEF" proteins (3)
SKU Description Size Price
LC415796 Lyophilized SPDEF HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415796 Transient overexpression lysate of SAM pointed domain containing ets transcription factor (SPDEF) (as WB positive control) 100 ug
$436.00
TP305688 Recombinant protein of human SAM pointed domain containing ets transcription factor (SPDEF), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products