OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

UBE2D1 (NM_003338) Human Mass Spec Standard

Be the first to review this product
SKU
PH305621
UBE2D1 MS Standard C13 and N15-labeled recombinant protein (NP_003329)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA803633 UBE2D1 mouse monoclonal antibody, clone OTI1E7 (formerly 1E7) 100 ul
$447.00
LY418756 Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog, yeast) (UBE2D1) (as WB positive control) 100 ug
$436.00

Other products for "UBE2D1 or NM_003338"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205621
Predicted MW 16.4 kDa
Protein Sequence
Protein Sequence
>RC205621 representing NM_003338
Red=Cloning site Green=Tags(s)

MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFT
TKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHARE
WTQKYAM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003329
RefSeq Size 2669
RefSeq ORF 441
Synonyms E2(17)KB1; SFT; UBC4/5; UBCH5; UBCH5A
Locus ID 7321
UniProt ID P51668
Cytogenetics 10q21.1
Summary The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is closely related to a stimulator of iron transport (SFT), and is up-regulated in hereditary hemochromatosis. It also functions in the ubiquitination of the tumor-suppressor protein p53 and the hypoxia-inducible transcription factor HIF1alpha by interacting with the E1 ubiquitin-activating enzyme and the E3 ubiquitin-protein ligases. Two transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Mar 2011
Protein Pathways Ubiquitin mediated proteolysis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "UBE2D1" proteins (4)
SKU Description Size Price
LC418756 Lyophilized UBE2D1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418756 Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog, yeast) (UBE2D1) (as WB positive control) 100 ug
$436.00
TP305621 Recombinant protein of human ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog, yeast) (UBE2D1), 20 µg 20 ug
$737.00
TP721188 Purified recombinant protein of Human ubiquitin-conjugating enzyme E2D 1 (UBE2D1), transcript variant 1 10 ug
$150.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products