OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SAP18 (NM_005870) Human Mass Spec Standard

Be the first to review this product
SKU
PH305607
SAP18 MS Standard C13 and N15-labeled recombinant protein (NP_005861)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY417012 Transient overexpression lysate of Sin3A-associated protein, 18kDa (SAP18) (as WB positive control) 100 ug
$436.00

Other products for "SAP18 or NM_005870"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205607
Predicted MW 17.6 kDa
Protein Sequence
Protein Sequence
>RC205607 protein sequence
Red=Cloning site Green=Tags(s)

MAVESRVTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELT
SLVKEVYPEARKKGTHFNFAIVFTDVKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPP
NRAPPTSGRMRPY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005861
RefSeq Size 2318
RefSeq ORF 459
Synonyms 2HOR0202; SAP18P
Locus ID 10284
UniProt ID O00422
Cytogenetics 13q12.11
Summary Histone acetylation plays a key role in the regulation of eukaryotic gene expression. Histone acetylation and deacetylation are catalyzed by multisubunit complexes. The protein encoded by this gene is a component of the histone deacetylase complex, which includes SIN3, SAP30, HDAC1, HDAC2, RbAp46, RbAp48, and other polypeptides. This protein directly interacts with SIN3 and enhances SIN3-mediated transcriptional repression when tethered to the promoter. A pseudogene has been identified on chromosome 2. provided by RefSeq, Dec 2008
Protein Families Druggable Genome, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SAP18" proteins (3)
SKU Description Size Price
LC417012 Lyophilized SAP18 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417012 Transient overexpression lysate of Sin3A-associated protein, 18kDa (SAP18) (as WB positive control) 100 ug
$436.00
TP305607 Recombinant protein of human Sin3A-associated protein, 18kDa (SAP18), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products