OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ATE1 (NM_007041) Human Mass Spec Standard

Be the first to review this product
SKU
PH305461
ATE1 MS Standard C13 and N15-labeled recombinant protein (NP_008972)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA372085 ATE1 rabbit polyclonal antibody
100 ul
$310.00
LY416240 Transient overexpression lysate of arginyltransferase 1 (ATE1), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "ATE1 or NM_007041"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205461
Predicted MW 59 kDa
Protein Sequence
Protein Sequence
>RC205461 protein sequence
Red=Cloning site Green=Tags(s)

MAFWAGGSPSVVDYFPSEDFYRCGYCKNESGSRSNGMWAHSMTVQDYQDLIDRGWRRSGKYVYKPVMNQT
CCPQYTIRCRPLQFQPSKSHKKVLKKMLKFLAKGEVPKGSCEDEPMDSTMDDAVAGDFALINKLDIQCDL
KTLSDDIKESLESEGKNSKKEEPQELLQSQDFVGEKLGSGEPSHSVKVHTVPKPGKGADLSKPPCRKAKE
IRKERKRLKLMQQNPAGELEGFQAQGHPPSLFPPKAKSNQPKSLEDLIFESLPENASHKLEVRLVPVSFE
DPEFKSSFSQSFSLYVKYQVAIHQDPPDECGKTEFTRFLCSSPLEAETPPNGPDCGYGSFHQQYWLDGKI
IAVGVIDILPNCVSSVYLYYDPDYSFLSLGVYSALREIAFTRQLHEKTSQLSYYYMGFYIHSCPKMKYKG
QYRPSDLLCPETYVWVPIEQCLPSLENSKYCRFNQDPEAVDEDRSTEPDRLQVFHKRAIMPYGVYKKQQK
DPSEEAAVLQYASLVGQKCSERMLLFRN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_008972
RefSeq Size 4930
RefSeq ORF 1554
Locus ID 11101
UniProt ID O95260
Cytogenetics 10q26.13
Summary This gene encodes an arginyltransferase, an enzyme that is involved in posttranslational conjugation of arginine to N-terminal aspartate or glutamate residues. Conjugation of arginine to the N-terminal aspartate or glutamate targets proteins for ubiquitin-dependent degradation. Alternative splicing results in multiple transcript variants. provided by RefSeq, Dec 2013
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ATE1" proteins (5)
SKU Description Size Price
LC416240 Lyophilized ATE1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424305 Lyophilized ATE1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416240 Transient overexpression lysate of arginyltransferase 1 (ATE1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY424305 Transient overexpression lysate of arginyltransferase 1 (ATE1), transcript variant 1 (as WB positive control) 100 ug
$665.00
TP305461 Recombinant protein of human arginyltransferase 1 (ATE1), transcript variant 2, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products