OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SYNPR (NM_144642) Human Mass Spec Standard

Be the first to review this product
SKU
PH305424
SYNPR MS Standard C13 and N15-labeled recombinant protein (NP_653243)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA342623 Rabbit Polyclonal Anti-SYNPR Antibody
100 ul
$585.00
LY403401 Transient overexpression lysate of synaptoporin (SYNPR), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "SYNPR or NM_144642"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205424
Predicted MW 29.2 kDa
Protein Sequence
Protein Sequence
>RC205424 protein sequence
Red=Cloning site Green=Tags(s)

MCMVIFAPLFAIFAFATCGGYSGGLRLSVDCVNKTESNLSIDIAFAYPFRLHQVTFEVPTCEGKERQKLA
LIGDSSSSAEFFVTVAVFAFLYSLAATVVYIFFQNKYRENNRGPLIDFIVTVVFSFLWLVGSSAWAKGLS
DVKVATDPKEVLLLMSACKQPSNKCMAIHSPVMSSLNTSVVFGFLNFILWAGNIWFVFKETGWHSSGQRY
LSDPMEKHSSSYNQGGYNQDSYGSSSGYSQQASLGPTSDEFGQQPTGPTSFTNQI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_653243
RefSeq Size 2632
RefSeq ORF 795
Synonyms SPO
Locus ID 132204
UniProt ID Q8TBG9
Cytogenetics 3p14.2
Summary Intrinsic membrane protein of small synaptic vesicles. Probable vesicular channel protein (By similarity).UniProtKB/Swiss-Prot Function
Protein Families Secreted Protein, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SYNPR" proteins (7)
SKU Description Size Price
PH325395 SYNPR MS Standard C13 and N15-labeled recombinant protein (NP_001123475) 10 ug
$3,360.00
LC403401 Lyophilized SYNPR HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427094 Lyophilized SYNPR HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403401 Transient overexpression lysate of synaptoporin (SYNPR), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY427094 Transient overexpression lysate of synaptoporin (SYNPR), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP305424 Recombinant protein of human synaptoporin (SYNPR), transcript variant 2, 20 µg 20 ug
$867.00
TP325395 Purified recombinant protein of Homo sapiens synaptoporin (SYNPR), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products