OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PDHA2 (NM_005390) Human Mass Spec Standard

Be the first to review this product
SKU
PH305416
PDHA2 MS Standard C13 and N15-labeled recombinant protein (NP_005381)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA379757 PDHA2 Rabbit polyclonal Antibody
100 ul
$410.00
LY417344 Transient overexpression lysate of pyruvate dehydrogenase (lipoamide) alpha 2 (PDHA2) (as WB positive control) 100 ug
$436.00

Other products for "PDHA2 or NM_005390"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205416
Predicted MW 42.9 kDa
Protein Sequence
Protein Sequence
>RC205416 protein sequence
Red=Cloning site Green=Tags(s)

MLAAFISRVLRRVAQKSARRVLVASRNSSNDATFEIKKCDLYLLEEGPPVTTVLTRAEGLKYYRMMLTVR
RMELKADQLYKQKFIRGFCHLCDGQEACCVGLEAGINPSDHVITSYRAHGVCYTRGLSVRSILAELTGRR
GGCAKGKGGSMHMYTKNFYGGNGIVGAQGPLGAGIALACKYKGNDEICLTLYGDGAANQGQIAEAFNMAA
LWKLPCVFICENNLYGMGTSTERAAASPDYYKRGNFIPGLKVDGMDVLCVREATKFAANYCRSGKGPILM
ELQTYRYHGHSMSDPGVSYRTREEIQEVRSKRDPIIILQDRMVNSKLATVEELKEIGAEVRKEIDDAAQF
ATTDPEPHLEELGHHIYSSDSSFEVRGANPWIKFKSVS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005381
RefSeq Size 1387
RefSeq ORF 1164
Synonyms PDHAL
Locus ID 5161
UniProt ID P29803
Cytogenetics 4q22.3
Summary The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2), and thereby links the glycolytic pathway to the tricarboxylic cycle.UniProtKB/Swiss-Prot Function
Protein Pathways Butanoate metabolism, Citrate cycle (TCA cycle), Glycolysis / Gluconeogenesis, leucine and isoleucine biosynthesis, Metabolic pathways, Pyruvate metabolism, Valine
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PDHA2" proteins (3)
SKU Description Size Price
LC417344 Lyophilized PDHA2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417344 Transient overexpression lysate of pyruvate dehydrogenase (lipoamide) alpha 2 (PDHA2) (as WB positive control) 100 ug
$436.00
TP305416 Recombinant protein of human pyruvate dehydrogenase (lipoamide) alpha 2 (PDHA2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products