OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PCP2 (NM_174895) Human Mass Spec Standard

Be the first to review this product
SKU
PH305399
PCP2 MS Standard C13 and N15-labeled recombinant protein (NP_777555)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA357101 PCP2 Antibody - N-terminal region
100 ul
$585.00
LY403562 Transient overexpression lysate of Purkinje cell protein 2 (PCP2) (as WB positive control) 100 ug
$436.00

Other products for "PCP2 or NM_174895"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205399
Predicted MW 14.5 kDa
Protein Sequence
Protein Sequence
>RC205399 protein sequence
Red=Cloning site Green=Tags(s)

MMDQEEKTEEGSGPCAEAGSPDQEGFFNLLSHVQGDRMEGQRCSLQAGPGQTTKSQSDPTPEMDSLMDML
ASTQGRRMDDQRVTVSSLPGFQPVGSKDGAQKRAGTLSPQPLLTPQDPTALGFRRNSSPQPPTQAP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_777555
RefSeq Size 789
RefSeq ORF 408
Synonyms GPSM4
Locus ID 126006
UniProt ID Q8IVA1
Cytogenetics 19p13.2
Summary May function as a cell-type specific modulator for G protein-mediated cell signaling.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PCP2" proteins (3)
SKU Description Size Price
LC403562 Lyophilized PCP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403562 Transient overexpression lysate of Purkinje cell protein 2 (PCP2) (as WB positive control) 100 ug
$436.00
TP305399 Recombinant protein of human Purkinje cell protein 2 (PCP2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products